KEGG   Escherichia coli K-12 MG1655: b3907
Entry
b3907             CDS       T00007                                 

Gene name
rhaT
Definition
(RefSeq) rhamnose/lyxose:H(+) symporter
  KO
K02856  L-rhamnose-H+ transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3907 (rhaT)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b3907 (rhaT)
SSDB
Motif
Pfam: RhaT
Other DBs
NCBI-GeneID: 948398
NCBI-ProteinID: NP_418343
Pasteur: rhaT
RegulonDB: ECK120001284
ECOCYC: EG11313
ASAP: ABE-0012749
UniProt: P27125
Position
complement(4099491..4100525)
AA seq 344 aa
MSNAITMGIFWHLIGAASAACFYAPFKKVKKWSWETMWSVGGIVSWIILPWAISALLLPN
FWAYYSSFSLSTRLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPI
INGNFDVLISTEGGRMTLLGVLVALIGVGIVTRAGQLKERKMGIKAEEFNLKKGLVLAVM
CGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGAIINLGFCFIRLAKVK
DLSLKADFSLAKSLIIHNVLLSTLGGLMWYLQFFFYAWGHARIPAQYDYISWMLHMSFYV
LCGGIVGLVLKEWNNAGRRPVTVLSLGCVVIIVAANIVGIGMAN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagtaacgcgattacgatggggatattttggcatttgatcggcgcggccagtgcagcc
tgtttttacgctccgttcaaaaaagtaaaaaaatggtcatgggaaaccatgtggtcagtc
ggtgggattgtttcgtggattattctgccgtgggccatcagcgccctgttactaccgaat
ttctgggcgtattacagctcgtttagtctctctacgcgactgcctgtttttctgttcggc
gctatgtgggggatcggtaatatcaactacggcctgaccatgcgttatctcggcatgtcg
atgggaattggcatcgccattggcattacgttgattgtcggtacgctgatgacgccaatt
atcaacggcaatttcgatgtgttgattagcaccgaaggcggacgcatgacgttgctcggc
gttctggtggcgctgattggcgtagggattgtaactcgcgccgggcagttgaaagagcgc
aagatgggcattaaagccgaagagttcaatctgaaaaaagggctggtgctggcggtgatg
tgcggcattttctctgccgggatgtcctttgcgatgaacgccgcaaaaccgatgcatgaa
gccgctgccgcacttggcgtcgatccactgtatgtcgctctgccaagctatgttgtcatc
atgggcggcggcgcgatcattaacctcggtttctgttttattcgtctggcaaaagtgaag
gatttgtcgctaaaagccgacttctcgctggcaaaatcgctgatcattcacaatgtgtta
ctctcgacactgggcgggttgatgtggtatctgcaattctttttctatgcctggggccac
gcccgcattccggcgcagtatgactacatcagttggatgctgcatatgagtttctatgta
ttgtgcggcggtatcgtcgggctggtgctgaaagagtggaacaatgcaggacgccgtccg
gtaacggtgttgagcctcggttgtgtggtgattattgtcgccgctaacatcgtcggcatc
ggcatggcgaattaa

DBGET integrated database retrieval system