KEGG   Escherichia coli K-12 MG1655: b3925Help
Entry
b3925             CDS       T00007                                 

Gene name
glpX
Definition
(RefSeq) fructose 1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00030  Pentose phosphate pathway
eco00051  Fructose and mannose metabolism
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Module
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b3925 (glpX)
   00030 Pentose phosphate pathway
    b3925 (glpX)
   00051 Fructose and mannose metabolism
    b3925 (glpX)
  Energy metabolism
   00680 Methane metabolism
    b3925 (glpX)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     b3925 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-GeneID: 948424
NCBI-ProteinID: NP_418360
Pasteur: glpX
RegulonDB: ECK120001472
ECOCYC: EG11517
ASAP: ABE-0012821
UniProt: P0A9C9
Structure
PDB: 

Position
complement(4114569..4115579)
Genome map
AA seq 336 aa AA seqDB search
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEI
DEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYM
EKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVR
VFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKG
DNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNI
ATTETLLIRGKSRTIRRIQSIHYLDRKDPEMQVHIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaacttgccatcgaattttcccgcgtcaccgaatcagcggcgctggctggc
tacaaatggttaggacgcggcgataaaaacaccgcggacggcgcggcggtaaacgccatg
cgtattatgctcaaccaggtcaacattgacggcaccatcgtcattggtgaaggtgaaatc
gacgaagcaccgatgctctacattggtgaaaaagtcggtactggtcgcggcgacgcggta
gatattgctgttgatccgattgaaggcacgcgcatgacggcgatgggccaggctaacgcg
ctggcggtgctggcagtaggcgataaaggctgcttcctcaatgcgccggatatgtatatg
gagaagctgattgtcgggccgggagccaaaggcaccattgatctgaacctgccgctggcg
gataacctgcgcaatgtagcggcggcgctcggcaaaccgttgagcgaactgacggtaacg
attctggctaaaccacgccacgatgccgttatcgctgaaatgcagcaactcggcgtacgc
gtatttgctattccggacggcgacgttgcggcctcaattctcacctgtatgccagacagc
gaagttgacgtgctgtacggtattggtggcgcgccggaaggcgtagtttctgcggcggtg
atccgcgcattagatggcgacatgaacggtcgtctgctggcgcgtcatgacgtcaaaggc
gacaacgaagagaatcgtcgcattggcgagcaggagctggcacgctgcaaagcgatgggc
atcgaagccggtaaagtattgcgcctgggcgatatggcgcgcagcgataacgtcatcttc
tctgccaccggtattaccaaaggcgatctgctggaaggcattagccgcaaaggcaatatc
gcgactaccgaaacgctgctgatccgcggcaagtcacgcaccattcgccgcattcagtcc
atccactatctggatcgcaaagacccggaaatgcaggtgcacatcctctga

DBGET integrated database retrieval system