KEGG   Escherichia coli K-12 MG1655: b3947Help
Entry
b3947             CDS       T00007                                 

Gene name
frwA
Definition
(RefSeq) putative PTS enzyme: Hpr, enzyme I and II components
  KO
K08483  phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
K11189  phosphocarrier protein
K11201  PTS system, fructose-specific IIA-like component [EC:2.7.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02060  Phosphotransferase system (PTS)
Module
eco_M00306  PTS system, fructose-specific II-like component
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    b3947 (frwA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3947 (frwA)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     b3947 (frwA)
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     b3947 (frwA)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    b3947 (frwA)
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    b3947 (frwA)
  Enzyme II [TC:4.A]
   Fructose-specific II-like component [MD:M00306]
    b3947 (frwA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PTS_EIIA_2 PEP-utilizers PTS-HPr PEP-utilisers_N
Motif
Other DBs
NCBI-GeneID: 948437
NCBI-ProteinID: YP_026278
RegulonDB: ECK120001835
ASAP: ABE-0012920
UniProt: P32670
Position
complement(4139720..4142221)
Genome map
AA seq 833 aa AA seqDB search
MALIVEFICELPNGVHARPASHVETLCNTFSSQIEWHNLRTDRKGNAKSALALIGTDTLA
GDNCQLLISGADEQEAHQRLSQWLRDEFPHCDAPLAEVKSDELEPLPVSLTNLNPQIIRA
RTVCSGSAGGILTPISSLDLNALGNLPAAKGVDAEQSALENGLTLVLKNIEFRLLDSDGA
TSAILEAHRSLAGDTSLREHLLAGVSAGLSCAEAIVASANHFCEEFSRSSSSYLQERALD
VRDVCFQLLQQIYGEQRFPAPGKLTQPAICMADELTPSQFLELDKNHLKGLLLKSGGTTS
HTVILARSFNIPTLVGVDIDALTPWQQQTIYIDGNAGAIVVEPGEAVARYYQQEARVQDA
LREQQRVWLTQQARTADGIRIEIAANIAHSVEAQAAFGNGAEGVGLFRTEMLYMDRTSAP
GESELYNIFCQALESANGRSIIVRTMDIGGDKPVDYLNIPAEANPFLGYRAVRIYEEYAS
LFTTQLRSILRASAHGSLKIMIPMISSMEEILWVKEKLAEAKQQLRNEHIPFDEKIQLGI
MLEVPSVMFIIDQCCEEIDFFSIGSNDLTQYLLAVDRDNAKVTRHYNSLNPAFLRALDYA
VQAVHRQGKWIGLCGELGAKGSVLPLLVGLGLDELSMSAPSIPAAKARMAQLDSRECRKL
LNQAMACRTSLEVEHLLAQFRMTQQDAPLVTAECITLESDWRSKEEVLKGMTDNLLLAGR
CRYPRKLEADLWAREAVFSTGLGFSFAIPHSKSEHIEQSTISVARLQAPVRWGDDEAQFI
IMLTLNKHAAGDQHMRIFSRLARRIMHEEFRNALVNAASADAIASLLQHELEL
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggccctgattgtggaatttatttgtgagctacctaacggcgtacatgcgcgtccggca
agccacgttgaaacgctgtgtaatactttttcatcacaaattgagtggcataacctgcgc
actgaccgcaagggcaacgccaaaagcgcccttgcgctgattggcaccgatacgctggcg
ggcgataactgccagttactgatttccggggccgacgaacaggaagcgcaccagcgttta
agccaatggctgcgcgatgaattcccccactgcgatgcgccgctggcggaagttaaatct
gacgaactggaaccactgccggtttcactgaccaatctgaatccgcaaattatccgcgcc
cgcaccgtgtgcagcggtagtgcaggcggcattctgacgccgatctcttctttagatctc
aatgcgctgggtaatcttcccgcagccaaaggcgttgacgccgagcaatccgcactggaa
aacggcctgacgctggtactgaaaaacattgagtttcgtctgctggatagcgacggtgct
accagcgcgattctggaagctcaccgatccctggctggcgatacttccctgcgcgaacat
ttactggcaggcgtcagcgccggattaagctgcgccgaagcaattgttgccagcgcgaat
cacttttgcgaagagttttcccgttccagcagcagctacctgcaagaacgtgccctggac
gtacgcgacgtctgcttccagttactccagcaaatctacggtgagcaacgcttcccggca
ccgggcaaactgacgcagcccgccatttgtatggctgatgaactgacccccagccagttc
ctcgaactggataaaaatcacctcaaaggattgttgctcaaaagcggcggcaccacctca
catacggtgatccttgcccgttcgttcaacattccaacgctggttggtgtggatattgat
gcccttactccgtggcagcaacaaacgatttatatcgacggcaacgccggggcgattgtg
gttgagccaggggaagccgtagctcgttattatcagcaagaagcccgcgtacaggacgcc
ctgcgtgagcaacagcgtgtctggctgacccaacaagcccgtaccgctgacggtatccgc
attgaaattgccgctaacatcgctcactccgtggaagcgcaggccgcattcggcaatggt
gcggaaggcgttggtttgttccgcactgaaatgctctatatggatcgcaccagcgcaccg
ggcgaaagcgagttgtacaacattttttgtcaggcgctggaatccgccaacggacgcagc
attattgtgcgcactatggacattggcggcgacaaacccgttgattatctgaacattccc
gcagaggcaaacccgttcctcggttatcgcgccgtgcgtatttatgaagagtacgcgtcg
ttgtttaccacgcagctacggtcgatcctccgcgcctccgctcacggcagcctgaaaatc
atgatcccgatgatctcctcaatggaagagatcttatgggtgaaagaaaaactggcggaa
gccaaacagcaactacgtaacgaacacattccgtttgatgagaaaatccagctcggcatc
atgctggaagtgccgtcggtgatgttcatcatcgatcaatgctgcgaagagattgatttc
tttagtattggtagtaatgacctgacgcagtatctgctggcggtggatcgcgataacgct
aaggttactcgtcactacaacagcctgaatccggcattcttgcgggcgctcgattacgcc
gtgcaagcggtgcatcgccagggcaaatggattggtctgtgcggtgagctgggagcgaaa
ggttccgtgctgccgttgctggtcggcttagggctggatgaactcagcatgagcgcacca
tcaattccggcggcgaaagctcggatggcgcaacttgatagccgtgagtgccgcaagttg
ctcaaccaggcaatggcctgccgtacttcgctggaagtagaacacctgctggcgcaattc
cgcatgacccaacaagacgcaccgctggtcaccgccgagtgcatcacactggaaagcgac
tggcgcagcaaagaagaagtgctcaaaggcatgaccgataacctgctgctggcgggccgc
tgccgctatccgcgtaaactggaagccgacttgtgggcgcgcgaggccgttttctctacc
ggtctgggctttagttttgccattccacacagcaaatcagaacacattgagcaatccacc
atcagcgtggcgcgtctgcaagcgccggtgcgctggggcgatgatgaagcgcaattcatc
attatgttaaccctgaacaaacacgctgcgggcgatcagcatatgcgcattttctcgcgc
ctcgctcgccgcatcatgcacgaagaattccgtaacgcgctggttaacgccgcctctgcc
gacgctatcgccagcctgctgcaacatgaactggaactgtaa

DBGET integrated database retrieval system