KEGG   Escherichia coli K-12 MG1655: b3952Help
Entry
b3952             CDS       T00007                                 

Gene name
pflC
Definition
(RefSeq) putative [formate-C-acetyltransferase 2]-activating enzyme; pyruvate formate-lyase 1-activating enzyme
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b3952 (pflC)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     b3952 (pflC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14 Fer4_6 Fer4_9
Motif
Other DBs
NCBI-GeneID: 948453
NCBI-ProteinID: NP_418387
Pasteur: pflC
RegulonDB: ECK120001839
ECOCYC: EG11911
ASAP: ABE-0012937
UniProt: P32675
Position
4146258..4147136
Genome map
AA seq 292 aa AA seqDB search
MTSSAGQRISCNVVETRRDDVARIFNIQRYSLNDGEGIRTVVFFKGCPHLCPWCANPESI
SGKIQTVRREAKCLHCAKCLRDADECPSGAFERIGRDISLDALEREVMKDDIFFRTSGGG
VTLSGGEVLMQAEFATRFLQRLRLWGVSCAIETAGDAPASKLLPLAKLCDEVLFDLKIMD
ATQARDVVKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTLSRENMQQALDVLIPLNIRQ
IHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVATMREMAERAGLQVTVGG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatccgccggacagcgcatcagctgtaacgttgtggaaacgcgccgcgatgat
gtggcgcgcattttcaacattcagcgttattcactgaatgacggcgagggcattcgtacg
gtggtcttttttaaaggctgtccgcatctttgcccgtggtgtgctaatccggagtcgatc
tccggcaaaatccagacggtacgcagagaggcgaaatgtctgcactgtgcgaaatgtttg
cgtgatgcggatgaatgcccctccggggcgtttgaacggattggtcgcgatatcagcctt
gacgctctggaacgggaagtgatgaaagatgacattttctttcgcacgtccggcggcggc
gtcacgctttctggcggcgaagtgttaatgcaggcggagtttgctacccgttttttacag
cgactgcggctgtggggtgtgtcatgcgccattgaaactgccggagacgcaccagccagc
aagctattaccgctggcgaaattgtgcgatgaagtgttgttcgatttaaaaattatggac
gcgactcaggcgcgggatgtggtgaagatgaacctgccacgcgtgctggagaatctgcgt
ttgctggtgagtgagggcgtcaacgtgatcccgcgtttaccgctgatccctggtttcacg
ctcagccgggagaatatgcagcaggcgctggatgtactgatcccgctgaatatcaggcag
atccatctgttaccgtttcatcagtacggcgaaccgaaataccgcctgctggggaaaaca
tggtcgatgaaagaggtgcctgcgccgtcgtcagctgatgtggcaacgatgcgcgaaatg
gcagaacgggccggacttcaggttaccgtgggaggttaa

DBGET integrated database retrieval system