KEGG   Escherichia coli K-12 MG1655: b3953Help
Entry
b3953             CDS       T00007                                 

Gene name
frwD
Definition
(RefSeq) putative enzyme IIB component of PTS
  KO
K11202  PTS system, fructose-specific IIB-like component [EC:2.7.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00306  PTS system, fructose-specific II-like component
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3953 (frwD)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     b3953 (frwD)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II-like component [MD:M00306]
    b3953 (frwD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-GeneID: 948452
NCBI-ProteinID: NP_418388
Pasteur: frwD
RegulonDB: ECK120001840
ECOCYC: EG11912
ASAP: ABE-0012941
UniProt: P32676
Structure
PDB: 

Position
4147138..4147479
Genome map
AA seq 113 aa AA seqDB search
MAYLVAVTACVSGVAHTYMAAERLEKLCLLEKWGVSIETQGALGTENRLADEDIRRADVA
LLITDIELAGAERFEHCRYVQCSIYAFLREPQRVMSAVRKVLSAPQQTHLILE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcatacctggtggcagtaaccgcctgcgtaagcggcgtggcgcatacttatatggcg
gcggaacggctggaaaagttgtgcctgttagagaagtggggagtcagcattgaaactcag
ggcgcgctgggaacggagaatcgtttagcggatgaggatatccgccgggcggatgttgct
ctgttgattacggatatcgagcttgccggtgccgagcgatttgaacattgccgctatgtg
caatgcagcatctacgcattcctgcgtgagccgcagcgggtaatgagcgcggtgcgcaaa
gtgctttctgcgccgcagcaaacccatcttattctggagtag

DBGET integrated database retrieval system