KEGG   Escherichia coli K-12 MG1655: b3958Help
Entry
b3958             CDS       T00007                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamylphosphate reductase, NAD(P)-binding
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01210  2-Oxocarboxylic acid metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    b3958 (argC)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     b3958 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC DapB_N GFO_IDH_MocA Epimerase NmrA DUF4459
Motif
Other DBs
NCBI-GeneID: 948455
NCBI-ProteinID: NP_418393
Pasteur: argC
RegulonDB: ECK120000061
ECOCYC: EG10065
ASAP: ABE-0012964
UniProt: P11446
Position
4155001..4156005
Genome map
AA seq 334 aa AA seqDB search
MLNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVDLPL
QPMSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYEKYYGF
THQYPELLEQAAYGLAEWCGNKLKEANLIAVPGCYPTAAQLALKPLIDADLLDLNQWPVI
NATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHLGADVIFTPHLGNFPRGIL
ETITCRLKSGVTQAQVAQVLQQAYAHKPLVRLYDKGVPALKNVVGLPFCDIGFAVQGEHL
IIVATEDNLLKGAAAQAVQCANIRFGYAETQSLI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatacgctgattgtgggtgccagcggctacgctggcgcagagctagtgacctat
gtaaatcgccatccgcatatgaacataaccgctttgactgtttcagcgcaaagcaatgat
gcgggaaagttaatctccgatttgcatccgcagctaaaaggcatcgttgatctgccgttg
cagccgatgtcggatatcagcgagtttagcccaggggtggacgtagtgtttctcgccacc
gcccatgaagttagccacgatttagcgccgcagtttcttgaagcgggctgcgtggtgttc
gacctttccggcgcgtttcgtgttaacgacgccaccttctatgaaaaatattacggcttt
acccatcaatacccggaactgttggaacaggcagcctacggtctggcggagtggtgcggt
aataaattaaaagaagcgaatttgattgcggtgccgggctgttatccgacggcggcacag
ctggcgctgaaaccgttgattgatgccgatcttcttgacctcaatcagtggccggtgatc
aacgccaccagcggcgtgagcggtgcagggcgtaaagcggccatttcaaacagcttttgt
gaagttagcctgcaaccgtatggcgtctttactcatcgccatcaaccagagatcgccaca
cacctcggtgctgacgttatcttcaccccacatctgggcaatttcccgcgcggcattctc
gaaaccattacctgccgcctgaaatcgggtgtgacccaggcgcaagtcgcgcaagtgtta
cagcaggcgtatgcccataaaccgctggtgcggctgtatgacaaaggcgttccggcgctg
aaaaatgtcgttgggctgccattttgcgatatcgggtttgccgttcagggcgagcatctg
attattgtggcgaccgaagacaacttactgaaaggcgcggcggcacaagcggtacagtgc
gccaatattcgtttcggctatgcggaaacgcagtctcttatttaa

DBGET integrated database retrieval system