KEGG   Escherichia coli K-12 MG1655: b3960Help
Entry
b3960             CDS       T00007                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco00250  Alanine, aspartate and glutamate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01230  Biosynthesis of amino acids
Module
eco_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b3960 (argH)
   00220 Arginine biosynthesis
    b3960 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eco04147]
    b3960 (argH)
Enzymes [BR:eco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     b3960 (argH)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b3960 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2 FUSC
Motif
Other DBs
NCBI-GeneID: 948463
NCBI-ProteinID: NP_418395
Pasteur: argH
RegulonDB: ECK120001201
ECOCYC: EG11223
ASAP: ABE-0012969
UniProt: P11447
Structure
PDB: 

Position
4156850..4158223
Genome map
AA seq 457 aa AA seqDB search
MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEE
ALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLW
CKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
AAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDED
VYPILSLQSCLDKRAAKGGVSPQQVAQAIAFAQARLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggggcgggcgttttacccaggcagcagatcaacggttcaaacaattcaac
gactcactgcgctttgattaccgtctggcggagcaggatattgttggctctgtggcctgg
tccaaagccctggtcacggtaggcgtgttaaccgcagaagagcaggcgcaactggaagag
gcgctgaacgtgttgctggaagatgttcgcgccaggccacaacaaatccttgaaagcgac
gccgaagatatccatagctgggtggaaggcaaactgatcgacaaagtgggccagttaggc
aaaaagctgcataccgggcgtagccgtaatgatcaggtagcgactgacctgaaactgtgg
tgcaaagataccgttagcgagttactgacggctaaccggcagctgcaatcggcgctggtg
gaaaccgcacaaaacaatcaggacgcggtaatgccaggttacactcacctgcaacgcgcc
cagccggtgacgttcgcgcactggtgcctggcctatgttgagatgctggcgcgtgatgaa
agccgtttgcaggatgcgcttaagcgtctggatgtcagcccgctaggctgtggcgcgctg
gcgggaacggcctatgaaatcgaccgtgaacagttagcaggctggctgggctttgcttcg
gcgacccgtaacagtctcgacagcgtttctgaccgtgaccatgtgttggaactgctttct
gctgccgctatcggcatggtgcatctgtcgcgttttgctgaagatctgattttctttaac
accggcgaagcggggtttgtggagctttctgaccgcgtgacttccggttcatcattaatg
ccgcagaagaaaaacccggatgcgctggagctgattcgcggtaaatgcggccgggtgcag
ggggcgttaaccggcatgatgatgacgctgaaaggtttgccgctggcttacaacaaagat
atgcaggaagacaaagaaggtctgttcgacgcgctcgatacctggctggactgcctgcat
atggcggcgctggtgctggacggcattcaggtgaaacgtccacgttgccaggaagcggct
cagcagggttacgccaacgccaccgaactggcggattatctggtggcgaaaggcgtaccg
ttccgcgaggcgcaccatattgttggtgaagcggtggtggaagccattcgtcagggcaaa
ccgctggaagatctgccgctcagtgagttgcagaaattcagtcaggtgattgacgaagat
gtctatccgattctgtcgctgcaatcgtgcctcgacaagcgtgcggcaaaaggcggcgtc
tcaccgcagcaggtggcgcaggcgattgcttttgcgcaggctcggttagggtaa

DBGET integrated database retrieval system