KEGG   Escherichia coli K-12 MG1655: b3962
Entry
b3962             CDS       T00007                                 

Gene name
sthA
Definition
(RefSeq) soluble pyridine nucleotide transhydrogenase
  KO
K00322  NAD(P) transhydrogenase [EC:1.6.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00760  Nicotinate and nicotinamide metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b3962 (sthA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.1  NAD(P)+ transhydrogenase (Si-specific)
     b3962 (sthA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored NAD_binding_8 FAD_binding_2 Thi4 GIDA HI0933_like AlaDh_PNT_C FAD_binding_3 DAO K_oxygenase 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 948461
NCBI-ProteinID: NP_418397
RegulonDB: ECK120001392
ECOCYC: EG11428
ASAP: ABE-0012975
UniProt: P27306
Position
complement(4159390..4160790)
AA seq 466 aa
MPHSYDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGCTHWGTIPSKALRHAV
SRIIEFNQNPLYSDHSRLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFV
DEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTHPRIYDSDSILSMHHEPRHVL
IYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQ
TAQPHVYAVGDVIGYPSLASAAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVG
KTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILFHRETKEILGIHCFGERAAEI
IHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgccacattcctacgattacgatgccatagtaataggttccggccccggcggcgaaggc
gctgcaatgggcctggttaagcaaggtgcgcgcgtcgcagttatcgagcgttatcaaaat
gttggcggcggttgcacccactggggcaccatcccgtcgaaagctctccgtcacgccgtc
agccgcattatagaattcaatcaaaacccactttacagcgaccattcccgactgctccgc
tcttcttttgccgatatccttaaccatgccgataacgtgattaatcaacaaacgcgcatg
cgtcagggattttacgaacgtaatcactgtgaaatattgcagggaaacgctcgctttgtt
gacgagcatacgttggcgctggattgcccggacggcagcgttgaaacactaaccgctgaa
aaatttgttattgcctgcggctctcgtccatatcatccaacagatgttgatttcacccat
ccacgcatttacgacagcgactcaattctcagcatgcaccacgaaccgcgccatgtactt
atctatggtgctggagtgatcggctgtgaatatgcgtcgatcttccgcggtatggatgta
aaagtggatctgatcaacacccgcgatcgcctgctggcatttctcgatcaagagatgtca
gattctctctcctatcacttctggaacagtggcgtagtgattcgtcacaacgaagagtac
gagaagatcgaaggctgtgacgatggtgtgatcatgcatctgaagtcgggtaaaaaactg
aaagctgactgcctgctctatgccaacggtcgcaccggtaataccgattcgctggcgtta
cagaacattgggctagaaactgacagccgcggacagctgaaggtcaacagcatgtatcag
accgcacagccacacgtttacgcggtgggcgacgtgattggttatccgagcctggcgtcg
gcggcctatgaccaggggcgcattgccgcgcaggcgctggtaaaaggcgaagccaccgca
catctgattgaagatatccctaccggtatttacaccatcccggaaatcagctctgtgggc
aaaaccgaacagcagctgaccgcaatgaaagtgccatatgaagtgggccgcgcccagttt
aaacatctggcacgcgcacaaatcgtcggcatgaacgtgggcacgctgaaaattttgttc
catcgggaaacaaaagagattctgggtattcactgctttggcgagcgcgctgccgaaatt
attcatatcggtcaggcgattatggaacagaaaggtggcggcaacactattgagtacttc
gtcaacaccacctttaactacccgacgatggcggaagcctatcgggtagctgcgttaaac
ggtttaaaccgcctgttttaa

DBGET integrated database retrieval system