KEGG   Escherichia coli K-12 MG1655: b3963Help
Entry
b3963             CDS       T00007                                 

Gene name
fabR
Definition
(RefSeq) transcriptional repressor of fabA and fabB
  KO
K22105  TetR/AcrR family transcriptional regulator, fatty acid biosynthesis regulator
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b3963 (fabR)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    b3963 (fabR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N WHG
Motif
Other DBs
NCBI-GeneID: 948460
NCBI-ProteinID: NP_418398
Pasteur: yijC
RegulonDB: ECK120001361
ECOCYC: EG11394
ASAP: ABE-0012979
UniProt: P0ACU5
Position
4161124..4161771
Genome map
AA seq 215 aa AA seqDB search
MGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFRDVDELGL
TMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPNAFRLLLRERSGTSAAF
RAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVTIVFSAGAEALDVGVEQRRQLE
ERLVLQLRMISKGAYYWYRREQEKTAIIPGNVKDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaagagcgcaacaaaaagaaaaaacccgccgttcgctggtggaagccgcattt
agccaattaagtgctgaacgcagcttcgccagcctgagtttgcgtgaagtggcgcgtgaa
gcgggcattgctcccacctctttttatcggcatttccgcgacgtagacgaactgggtctg
accatggttgatgagagcggtttaatgctacgccaactcatgcgccaggcgcgtcagcgt
atcgccaaaggcgggagtgtgatccgcacctcggtctccacatttatggagttcatcggt
aataatcctaacgccttccggttattattgcgggaacgctccggcacctccgctgcgttt
cgtgccgccgttgcgcgtgaaattcagcacttcattgcggaacttgcggactatctggaa
ctcgaaaaccatatgccgcgtgcgtttactgaagcgcaagccgaagcaatggtgacaatt
gtcttcagtgcgggtgccgaggcgttggacgtcggcgtcgaacaacgtcggcaattagaa
gagcgactggtactgcaactgcgaatgatttcgaaaggggcttattactggtatcgccgt
gaacaagagaaaaccgcaattattccgggaaatgtgaaggacgagtaa

DBGET integrated database retrieval system