KEGG   Escherichia coli K-12 MG1655: b3964Help
Entry
b3964             CDS       T00007                                 

Gene name
yijD
Definition
(RefSeq) DUF1422 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1422 Bax1-I DUF4018
Motif
Other DBs
NCBI-GeneID: 948459
NCBI-ProteinID: NP_418399
Pasteur: yijD
RegulonDB: ECK120001362
ECOCYC: EG11395
ASAP: ABE-0012981
UniProt: P0AF40
Position
4161771..4162130
Genome map
AA seq 119 aa AA seqDB search
MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMP
VGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcaaatcaagatagaggtacgctgctgctggcgttagttgctggcttatcg
attaatggtactttcgcagcgctgtttagctccattgtgccattttctgtattcccgatt
atttccctggtgctgacggtttactgcctgcatcaacgttatcttaatcgcactatgccg
gtaggcttgccgggtctggcagctgcctgttttattctcggcgtactgctgtacagcacg
gtagttcgtgcggaatatccggatatcggctctaacttcttcccggcagtactctccgtc
attatggtgttctggattggcgcgaagatgcgtaaccgtaagcaggaagttgctgagtaa

DBGET integrated database retrieval system