KEGG   Escherichia coli K-12 MG1655: b3981Help
Entry
b3981             CDS       T00007                                 

Gene name
secE
Definition
(RefSeq) preprotein translocase membrane subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02024  Quorum sensing
eco03060  Protein export
eco03070  Bacterial secretion system
Module
eco_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    b3981 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    b3981 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b3981 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eco02044]
    b3981 (secE)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   b3981 (secE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE
Motif
Other DBs
NCBI-GeneID: 948486
NCBI-ProteinID: NP_418408
Pasteur: secE
RegulonDB: ECK120000928
ECOCYC: EG10939
ASAP: ABE-0013023
UniProt: P0AG96
Structure
PDB: 

Position
4177358..4177741
Genome map
AA seq 127 aa AA seqDB search
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaataccgaagctcaaggaagcgggcgcggcctggaagcgatgaagtgggtc
gttgtggtggcattgctcctggtggcgattgtcggcaactatctttatcgcgacattatg
ctgccgctgcgtgcgctggccgtagtaattctgattgctgcagcgggtggtgtcgcgctg
ttaacgacaaaaggtaaagctaccgttgcttttgcccgtgaagcgcgtaccgaagtccgt
aaggtcatttggccgactcgccaggaaacattgcacaccacgctgattgtggctgcggtt
accgcagtaatgtcactgatcctgtggggactggatggtattctggttcgcctggtatcc
tttatcactggcctgaggttctga

DBGET integrated database retrieval system