KEGG   Escherichia coli K-12 MG1655: b3983Help
Entry
b3983             CDS       T00007                                 

Gene name
rplK
Definition
(RefSeq) 50S ribosomal subunit protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    b3983 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eco03011]
    b3983 (rplK)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    b3983 (rplK)
  Bacteria
    b3983 (rplK)
  Archaea
    b3983 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11 DUF3140
Motif
Other DBs
NCBI-GeneID: 948484
NCBI-ProteinID: NP_418410
Pasteur: rplK
RegulonDB: ECK120000863
ECOCYC: EG10872
ASAP: ABE-0013029
UniProt: P0A7J7
Structure
PDB: 

Position
4178447..4178875
Genome map
AA seq 142 aa AA seqDB search
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGA
DIEAMTRSIEGTARSMGLVVED
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaagtacaagcctatgtcaagctgcaggttgcagctggtatggctaacccg
agtccgccagtaggtccggctctgggtcagcagggcgtaaacatcatggaattctgcaaa
gcgttcaacgcaaaaactgattccatcgaaaaaggtctgccgattccggtagtaatcacc
gtttacgctgaccgttctttcactttcgttaccaagaccccgccggcagcagttctgctg
aaaaaagcggctggtatcaagtctggttccggtaagccgaacaaagacaaagtgggtaaa
atttcccgcgctcagctgcaggaaatcgcgcagaccaaagctgccgacatgactggtgcc
gacattgaagcgatgactcgctccatcgaaggtactgcacgttccatgggcctggtagtg
gaggactaa

DBGET integrated database retrieval system