KEGG   Escherichia coli K-12 MG1655: b3984Help
Entry
b3984             CDS       T00007                                 

Gene name
rplA
Definition
(RefSeq) 50S ribosomal subunit protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    b3984 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eco03011]
    b3984 (rplA)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    b3984 (rplA)
  Bacteria
    b3984 (rplA)
  Archaea
    b3984 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1
Motif
Other DBs
NCBI-GeneID: 948483
NCBI-ProteinID: NP_418411
Pasteur: rplA
RegulonDB: ECK120000855
ECOCYC: EG10864
ASAP: ABE-0013031
UniProt: P0A7L0
Structure
PDB: 

Position
4178879..4179583
Genome map
AA seq 234 aa AA seqDB search
MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKSDQNVR
GATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGEMNFDVVIASPDA
MRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDF
DADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactgaccaagcgcatgcgtgttatccgcgagaaagttgatgcaaccaaacag
tacgacatcaacgaagctatcgcactgctgaaagagctggcgactgctaaattcgtagaa
agcgtggacgtagctgttaacctcggcatcgacgctcgtaaatctgaccagaacgtacgt
ggtgcaactgtactgccgcacggtactggccgttccgttcgcgtagccgtatttacccaa
ggtgcaaacgctgaagctgctaaagctgcaggcgcagaactggtaggtatggaagatctg
gctgaccagatcaagaaaggcgaaatgaactttgacgttgttattgcttctccggatgca
atgcgcgttgttggccagctgggccaggttctgggtccgcgcggcctgatgccaaacccg
aaagtgggtactgtaacaccgaacgttgctgaagcggttaaaaacgctaaagctggccag
gttcgttaccgtaacgacaaaaacggcatcatccacaccaccatcggtaaagtggacttt
gacgctgacaaactgaaagaaaacctggaagctctgctggttgcgctgaaaaaagcaaaa
ccgactcaggcgaaaggcgtgtacatcaagaaagttagcatctccaccaccatgggtgca
ggtgttgcagttgaccaggctggcctgagcgcttctgtaaactaa

DBGET integrated database retrieval system