KEGG   Escherichia coli K-12 MG1655: b3987Help
Entry
b3987             CDS       T00007                                 

Gene name
rpoB
Definition
(RefSeq) RNA polymerase, beta subunit
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
eco03020  RNA polymerase
Module
eco_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b3987 (rpoB)
   00240 Pyrimidine metabolism
    b3987 (rpoB)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    b3987 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:eco03021]
    b3987 (rpoB)
   03400 DNA repair and recombination proteins [BR:eco03400]
    b3987 (rpoB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     b3987 (rpoB)
Transcription machinery [BR:eco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     b3987 (rpoB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      b3987 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_45 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 SPG4
Motif
Other DBs
NCBI-GeneID: 948488
NCBI-ProteinID: NP_418414
Pasteur: rpoB
RegulonDB: ECK120000885
ECOCYC: EG10894
ASAP: ABE-0013041
UniProt: P0A8V2
Structure
PDB: 

Position
4181245..4185273
Genome map
AA seq 1342 aa AA seqDB search
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggtttactcctataccgagaaaaaacgtattcgtaaggattttggtaaacgtccacaa
gttctggatgtaccttatctcctttctatccagcttgactcgtttcagaaatttatcgag
caagatcctgaagggcagtatggtctggaagctgctttccgttccgtattcccgattcag
agctacagcggtaattccgagctgcaatacgtcagctaccgccttggcgaaccggtgttt
gacgtccaggaatgtcaaatccgtggcgtgacctattccgcaccgctgcgcgttaaactg
cgtctggtgatctatgagcgcgaagcgccggaaggcaccgtaaaagacattaaagaacaa
gaagtctacatgggcgaaattccgctcatgacagacaacggtacctttgttatcaacggt
actgagcgtgttatcgtttcccagctgcaccgtagtccgggcgtcttctttgactccgac
aaaggtaaaacccactcttcgggtaaagtgctgtataacgcgcgtatcatcccttaccgt
ggttcctggctggacttcgaattcgatccgaaggacaacctgttcgtacgtatcgaccgt
cgccgtaaactgcctgcgaccatcattctgcgcgccctgaactacaccacagagcagatc
ctcgacctgttctttgaaaaagttatctttgaaatccgtgataacaagctgcagatggaa
ctggtgccggaacgcctgcgtggtgaaaccgcatcttttgacatcgaagctaacggtaaa
gtgtacgtagaaaaaggccgccgtatcactgcgcgccacattcgccagctggaaaaagac
gacgtcaaactgatcgaagtcccggttgagtacatcgcaggtaaagtggttgctaaagac
tatattgatgagtctaccggcgagctgatctgcgcagcgaacatggagctgagcctggat
ctgctggctaagctgagccagtctggtcacaagcgtatcgaaacgctgttcaccaacgat
ctggatcacggcccatatatctctgaaaccttacgtgtcgacccaactaacgaccgtctg
agcgcactggtagaaatctaccgcatgatgcgccctggcgagccgccgactcgtgaagca
gctgaaagcctgttcgagaacctgttcttctccgaagaccgttatgacttgtctgcggtt
ggtcgtatgaagttcaaccgttctctgctgcgcgaagaaatcgaaggttccggtatcctg
agcaaagacgacatcattgatgttatgaaaaagctcatcgatatccgtaacggtaaaggc
gaagtcgatgatatcgaccacctcggcaaccgtcgtatccgttccgttggcgaaatggcg
gaaaaccagttccgcgttggcctggtacgtgtagagcgtgcggtgaaagagcgtctgtct
ctgggcgatctggataccctgatgccacaggatatgatcaacgccaagccgatttccgca
gcagtgaaagagttcttcggttccagccagctgtctcagtttatggaccagaacaacccg
ctgtctgagattacgcacaaacgtcgtatctccgcactcggcccaggcggtctgacccgt
gaacgtgcaggcttcgaagttcgagacgtacacccgactcactacggtcgcgtatgtcca
atcgaaacccctgaaggtccgaacatcggtctgatcaactctctgtccgtgtacgcacag
actaacgaatacggcttccttgagactccgtatcgtaaagtgaccgacggtgttgtaact
gacgaaattcactacctgtctgctatcgaagaaggcaactacgttatcgcccaggcgaac
tccaacttggatgaagaaggccacttcgtagaagacctggtaacttgccgtagcaaaggc
gaatccagcttgttcagccgcgaccaggttgactacatggacgtatccacccagcaggtg
gtatccgtcggtgcgtccctgatcccgttcctggaacacgatgacgccaaccgtgcattg
atgggtgcgaacatgcaacgtcaggccgttccgactctgcgcgctgataagccgctggtt
ggtactggtatggaacgtgctgttgccgttgactccggtgtaactgcggtagctaaacgt
ggtggtgtcgttcagtacgtggatgcttcccgtatcgttatcaaagttaacgaagacgag
atgtatccgggtgaagcaggtatcgacatctacaacctgaccaaatacacccgttctaac
cagaacacctgtatcaaccagatgccgtgtgtgtctctgggtgaaccggttgaacgtggc
gacgtgctggcagacggtccgtccaccgacctcggtgaactggcgcttggtcagaacatg
cgcgtagcgttcatgccgtggaatggttacaacttcgaagactccatcctcgtatccgag
cgtgttgttcaggaagaccgtttcaccaccatccacattcaggaactggcgtgtgtgtcc
cgtgacaccaagctgggtccggaagagatcaccgctgacatcccgaacgtgggtgaagct
gcgctctccaaactggatgaatccggtatcgtttacattggtgcggaagtgaccggtggc
gacattctggttggtaaggtaacgccgaaaggtgaaactcagctgaccccagaagaaaaa
ctgctgcgtgcgatcttcggtgagaaagcctctgacgttaaagactcttctctgcgcgta
ccaaacggtgtatccggtacggttatcgacgttcaggtctttactcgcgatggcgtagaa
aaagacaaacgtgcgctggaaatcgaagaaatgcagctcaaacaggcgaagaaagacctg
tctgaagaactgcagatcctcgaagcgggtctgttcagccgtatccgtgctgtgctggta
gccggtggcgttgaagctgagaagctcgacaaactgccgcgcgatcgctggctggagctg
ggcctgacagacgaagagaaacaaaatcagctggaacagctggctgagcagtatgacgaa
ctgaaacacgagttcgagaagaaactcgaagcgaaacgccgcaaaatcacccagggcgac
gatctggcaccgggcgtgctgaagattgttaaggtatatctggcggttaaacgccgtatc
cagcctggtgacaagatggcaggtcgtcacggtaacaagggtgtaatttctaagatcaac
ccgatcgaagatatgccttacgatgaaaacggtacgccggtagacatcgtactgaacccg
ctgggcgtaccgtctcgtatgaacatcggtcagatcctcgaaacccacctgggtatggct
gcgaaaggtatcggcgacaagatcaacgccatgctgaaacagcagcaagaagtcgcgaaa
ctgcgcgaattcatccagcgtgcgtacgatctgggcgctgacgttcgtcagaaagttgac
ctgagtaccttcagcgatgaagaagttatgcgtctggctgaaaacctgcgcaaaggtatg
ccaatcgcaacgccggtgttcgacggtgcgaaagaagcagaaattaaagagctgctgaaa
cttggcgacctgccgacttccggtcagatccgcctgtacgatggtcgcactggtgaacag
ttcgagcgtccggtaaccgttggttacatgtacatgctgaaactgaaccacctggtcgac
gacaagatgcacgcgcgttccaccggttcttacagcctggttactcagcagccgctgggt
ggtaaggcacagttcggtggtcagcgtttcggggagatggaagtgtgggcgctggaagca
tacggcgcagcatacaccctgcaggaaatgctcaccgttaagtctgatgacgtgaacggt
cgtaccaagatgtataaaaacatcgtggacggcaaccatcagatggagccgggcatgcca
gaatccttcaacgtattgttgaaagagattcgttcgctgggtatcaacatcgaactggaa
gacgagtaa

DBGET integrated database retrieval system