KEGG   Escherichia coli K-12 MG1655: b3996Help
Entry
b3996             CDS       T00007                                 

Gene name
nudC
Definition
(RefSeq) NADH pyrophosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00760  Nicotinate and nicotinamide metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b3996 (nudC)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     b3996 (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase OrfB_Zn_ribbon DZR zinc_ribbon_2 C1_1
Motif
Other DBs
NCBI-GeneID: 948498
NCBI-ProteinID: YP_026280
Pasteur: yjaD
RegulonDB: ECK120001645
ECOCYC: EG11702
ASAP: ABE-0013063
UniProt: P32664
Structure
PDB: 

Position
4196903..4197676
Genome map
AA seq 257 aa AA seqDB search
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQ
RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtataattgaaaaattagatcacggctggtgggtcgtcagccatgaacaaaaa
ttatggttgccgaagggagaattgccatatggcgaagcggcaaatttcgatcttgtgggt
cagcgcgcactacaaatcggcgaatggcagggggaacctgtttggttagtacaacagcag
cggcgtcacgatatggggtcggtacgtcaggtcattgatctcgatgttgggctgtttcaa
ctggccggacgaggcgtacaactggcggagttttaccgatcgcataaatactgtggttac
tgcgggcatgaaatgtatccgagcaaaaccgaatgggcgatgctgtgcagccattgccgt
gagcgttactacccgcaaatcgccccctgcattattgttgccatccgtcgcgatgattcg
atcctcctcgcccagcatacccgccatcgtaacggtgtccatacagtacttgccggattc
gtcgaagtgggcgaaaccctcgagcaggcagtcgcgcgggaagtgatggaagagagcgga
attaaagttaaaaacttgcgttacgtgacttctcagccgtggccgtttcctcagtcttta
atgaccgcgtttatggcggaatatgacagcggcgacatcgtgatcgacccgaaagaattg
ctcgaggcgaactggtatcgctatgacgatttgccgttactcccgccgcccggcaccgta
gcgcgccgtctgatagaagatacggtggcgatgtgtcgggcagagtatgagtga

DBGET integrated database retrieval system