KEGG   Escherichia coli K-12 MG1655: b3999Help
Entry
b3999             CDS       T00007                                 

Gene name
yjaG
Definition
(RefSeq) DUF416 domain protein
  KO
K09891  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    b3999 (yjaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF416 Ribosomal_S7
Motif
Other DBs
NCBI-GeneID: 948501
NCBI-ProteinID: NP_418427
Pasteur: yjaG
RegulonDB: ECK120001844
ECOCYC: EG11916
ASAP: ABE-0013070
UniProt: P32680
Position
4199504..4200094
Genome map
AA seq 196 aa AA seqDB search
MLQNPIHLRLERLESWQHVTFMACLCERMYPNYAMFCQQTGFGDGQIYRRILDLIWETLT
VKDAKVNFDSQLEKFEEAIPSADDFDLYGVYPAIDACVALSELVHSRLSGETLEHAVEVS
KTSITTVAMLEMTQAGREMSDEELKENPAVEQEWDIQWEIFRLLAECEERDIELIKGLRA
DLREAGESNIGIIFQQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaacccaattcatctgcgtctggagcgcctggaaagctggcagcatgtcact
ttcatggcttgcttatgcgaacgcatgtaccccaattacgccatgttctgccagcaaacc
ggttttggtgatgggcaaatttaccgtcgcattctcgatctcatctgggaaacgctgacc
gttaaagacgcaaaagtaaatttcgacagccaactggagaaatttgaagaagcgattcct
tcagccgacgatttcgatctgtacggcgtttatccggcaatcgatgcctgcgtggcgtta
agtgaactggtccattcgcgtttgagtggtgaaacgctcgaacacgcggtggaagtgagt
aagacctccatcacgaccgttgcgatgctggaaatgactcaggctggtcgcgaaatgagc
gatgaagagcttaaagaaaacccagctgtagagcaagaatgggacattcagtgggaaata
ttccgacttttagctgagtgcgaagaacgcgatatcgagctgataaaaggccttagggca
gacctgcgtgaggcgggtgagagcaatattggtataatttttcagcaataa

DBGET integrated database retrieval system