KEGG   Escherichia coli K-12 MG1655: b4000Help
Entry
b4000             CDS       T00007                                 

Gene name
hupA
Definition
(RefSeq) DNA-binding protein HU-alpha
  KO
K05787  DNA-binding protein HU-alpha
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b4000 (hupA)
   03036 Chromosome and associated proteins [BR:eco03036]
    b4000 (hupA)
   03400 DNA repair and recombination proteins [BR:eco03400]
    b4000 (hupA)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    b4000 (hupA)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    b4000 (hupA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      b4000 (hupA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 NA37
Motif
Other DBs
NCBI-GeneID: 948499
NCBI-ProteinID: NP_418428
Pasteur: hupA
RegulonDB: ECK120000459
ECOCYC: EG10466
ASAP: ABE-0013077
UniProt: P0ACF0 A0A387D6B0
Structure
PDB: 

Position
4200281..4200553
Genome map
AA seq 90 aa AA seqDB search
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG
RNPQTGKEIKIAAANVPAFVSGKALKDAVK
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagactcaactgattgatgtaattgcagagaaagcagaactgtccaaaacccag
gctaaagctgctctggagtccactctggctgcaattactgagtctctgaaagaaggcgat
gctgtacaactggttggtttcggtaccttcaaagtgaaccaccgcgctgagcgtactggc
cgcaacccgcagaccggtaaagaaatcaaaattgccgcagctaacgtaccggcatttgtt
tctggcaaggcactgaaagacgcagttaagtaa

DBGET integrated database retrieval system