KEGG   Escherichia coli K-12 MG1655: b4001Help
Entry
b4001             CDS       T00007                                 

Gene name
yjaH
Definition
(RefSeq) DUF1481 family putative lipoprotein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1481 LPAM_1
Motif
Other DBs
NCBI-GeneID: 948508
NCBI-ProteinID: NP_418429
Pasteur: yjaH
RegulonDB: ECK120001845
ECOCYC: EG11917
ASAP: ABE-0013079
UniProt: P32681
Position
4200566..4201261
Genome map
AA seq 231 aa AA seqDB search
MNSFNEGVVSPLLSFWRRSLMLAGALLLTACSHNSSLPPFTASGFAEDQGAVRIWRKDSG
DNVHLLAVFSPWRSGDTTTREYRWQGDNLTLININVYSKPPVNIRARFDDRGDLSFMQRE
SDGEKQQLSNDQIDLYRYRADQIRQISDALRQGRVVLRQGRWHAMEQTVTTCEGQTIKPD
LDSQAIAHIERRQSRSSVDVSVAWLEAPEGSQLLLVANSDFCRWQPNEKTF
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagttttaacgaaggggtggtttcaccccttttgtctttctggcgtcgatcattg
atgctggctggcgctctgcttctcactgcctgtagtcataactcttcacttcctcccttt
accgccagtggatttgctgaagaccagggcgcggtacgcatctggcgaaaagacagcggc
gataatgtgcatctgcttgccgtgtttagcccgtggcgcagtggcgataccacgacgcga
gagtatcgctggcagggcgataacctcacgctcatcaatatcaatgtttacagcaaaccg
ccggtgaatattcgcgcgcgttttgacgatcgcggtgatctgagctttatgcaacgtgaa
tccgatggggaaaagcagcagctttctaacgaccaaatcgatttataccgttatcgtgct
gatcagatccgccagattagcgatgccttacgtcaggggagagtcgtgctgcgccagggg
cgctggcatgcgatggaacagaccgtgaccacctgcgaagggcaaaccattaaacctgat
ttagattcgcaggcgatagcgcatatcgagcgccgccagagccgctcttctgttgatgtc
agcgtggcatggctggaagcgcccgaaggttcgcaattactgttagtggcaaactctgat
ttctgtcgctggcaacccaacgagaaaacgttctga

DBGET integrated database retrieval system