KEGG   Escherichia coli K-12 MG1655: b4011Help
Entry
b4011             CDS       T00007                                 

Gene name
yjaA
Definition
(RefSeq) stress-induced protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3261
Motif
Other DBs
NCBI-GeneID: 948515
NCBI-ProteinID: NP_418435
Pasteur: yjaA
RegulonDB: ECK120001186
ECOCYC: EG11206
ASAP: ABE-0013112
UniProt: P09162
Position
4213234..4213617
Genome map
AA seq 127 aa AA seqDB search
MSVLYIQIRRNQITVRDLESKREVSGDAAFSNQRLLIANFFVAEKVLQDLVLQLHPRSTW
HSFLPAKRMDIVVSALEMNEGGLSQVEERILHEVVAGATLMKYRQFHIHAQSAVLSDSAV
MAMLKQK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttctgtatatccaaattcgtcgtaatcaaattactgttcgcgatcttgaaagc
aaacgtgaagtgtcaggagacgctgccttcagtaaccagcgcctgttaatcgccaatttc
tttgttgcagaaaaagttctgcaagatcttgttctgcaactccacccacgttcaacctgg
cattcttttttgccagcaaaacgtatggatattgttgtgagcgcactggaaatgaatgag
ggcggtttgtcacaggttgaggaacgcattctccatgaagtggtcgctggggcaacgtta
atgaaatatcgccagttccacatccatgcgcaatcagcggtactcagtgatagtgcggtc
atggcaatgcttaagcagaaataa

DBGET integrated database retrieval system