KEGG   Escherichia coli K-12 MG1655: b4012Help
Entry
b4012             CDS       T00007                                 

Gene name
yjaB
Definition
(RefSeq) GNAT-family putative N-acetyltransferase; acetyl coenzyme A-binding protein
  KO
K03827  putative acetyltransferase [EC:2.3.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b4012 (yjaB)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     b4012 (yjaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_6 Acetyltransf_CG Acetyltransf_4 Acetyltransf_3 DUF3749
Motif
Other DBs
NCBI-GeneID: 948514
NCBI-ProteinID: NP_418436
Pasteur: yjaB
RegulonDB: ECK120001187
ECOCYC: EG11207
ASAP: ABE-0013114
UniProt: P09163
Structure
PDB: 

Position
complement(4213680..4214123)
Genome map
AA seq 147 aa AA seqDB search
MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERD
QPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKV
GFKVTGRSEVDDLGKPYPLLNLAYVGA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggttattagtattcgccgctcacggcatgaggaaggggaggaactcgttgcgatttgg
tgtcgttctgtcgatgccactcacgattttctatcagcagagtatcggaccgagctggag
gacctagttcgttccttcctgccggaagcgccgttgtgggtcgcggttaatgagcgggat
cagccggttggatttatgttgctaagtgggcagcatatggatgcgctgtttatcgatcct
gatgtgcgcggctgcggcgtaggtcgggtgctggtggagcatgcgctctcgatggcaccg
gaactgacaaccaacgttaatgagcaaaatgagcaggcggttgggttctataagaaggtg
ggttttaaggttacgggacgctctgaggtggacgatttggggaaaccgtatccgttgctg
aatctggcgtatgtgggggcgtag

DBGET integrated database retrieval system