KEGG   Escherichia coli K-12 MG1655: b4023Help
Entry
b4023             CDS       T00007                                 

Gene name
yjbD
Definition
(RefSeq) DUF3811 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3811
Motif
Other DBs
NCBI-GeneID: 948518
NCBI-ProteinID: NP_418447
Pasteur: yjbD
RegulonDB: ECK120001850
ECOCYC: EG11922
ASAP: ABE-0013153
UniProt: P32685
Position
complement(4231359..4231631)
Genome map
AA seq 90 aa AA seqDB search
MALPRITQKEMTEREQRELKTLLDRARIAHGRVLTNSETNSIKKDYIDKLMVEREAEAKK
ARQLKKKQAYKPDPEASFSWSANTSTRGRR
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggcactcccccgtattacccaaaaagagatgactgaacgcgagcagcgtgaacttaaa
acactgctggatcgggcgcggattgcgcatggtcgcgtattgaccaactccgaaaccaac
agcattaagaaagattacatcgataaattaatggttgagcgtgaggctgaagcgaaaaaa
gcccgccagttgaagaaaaagcaggcttataaaccggatcctgaagcgtcatttagctgg
tcagcaaatacgtcgacgcgcggcaggcgctaa

DBGET integrated database retrieval system