KEGG   Escherichia coli K-12 MG1655: b4024Help
Entry
b4024             CDS       T00007                                 

Gene name
lysC
Definition
(RefSeq) lysine-sensitive aspartokinase 3
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00260  Glycine, serine and threonine metabolism
eco00261  Monobactam biosynthesis
eco00270  Cysteine and methionine metabolism
eco00300  Lysine biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01210  2-Oxocarboxylic acid metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
eco_M00017  Methionine biosynthesis, apartate => homoserine => methionine
eco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b4024 (lysC)
   00270 Cysteine and methionine metabolism
    b4024 (lysC)
   00300 Lysine biosynthesis
    b4024 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    b4024 (lysC)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     b4024 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7
Motif
Other DBs
NCBI-GeneID: 948531
NCBI-ProteinID: NP_418448
Pasteur: lysC
RegulonDB: ECK120000543
ECOCYC: EG10550
ASAP: ABE-0013156
UniProt: P08660
Structure
PDB: 

Position
complement(4231884..4233233)
Genome map
AA seq 449 aa AA seqDB search
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattgttgtctccaaatttggcggtaccagcgtagctgattttgacgccatg
aaccgcagcgctgatattgtgctttctgatgccaacgtgcgtttagttgtcctctcggct
tctgctggtatcactaatctgctggtcgctttagctgaaggactggaacctggcgagcga
ttcgaaaaactcgacgctatccgcaacatccagtttgccattctggaacgtctgcgttac
ccgaacgttatccgtgaagagattgaacgtctgctggagaacattactgttctggcagaa
gcggcggcgctggcaacgtctccggcgctgacagatgagctggtcagccacggcgagctg
atgtcgaccctgctgtttgttgagatcctgcgcgaacgcgatgttcaggcacagtggttt
gatgtacgtaaagtgatgcgtaccaacgaccgatttggtcgtgcagagccagatatagcc
gcgctggcggaactggccgcgctgcagctgctcccacgtctcaatgaaggcttagtgatc
acccagggatttatcggtagcgaaaataaaggtcgtacaacgacgcttggccgtggaggc
agcgattatacggcagccttgctggcggaggctttacacgcatctcgtgttgatatctgg
accgacgtcccgggcatctacaccaccgatccacgcgtagtttccgcagcaaaacgcatt
gatgaaatcgcgtttgccgaagcggcagagatggcaacttttggtgcaaaagtactgcat
ccggcaacgttgctacccgcagtacgcagcgatatcccggtctttgtcggctccagcaaa
gacccacgcgcaggtggtacgctggtgtgcaataaaactgaaaatccgccgctgttccgc
gctctggcgcttcgtcgcaatcagactctgctcactttgcacagcctgaatatgctgcat
tctcgcggtttcctcgcggaagttttcggcatcctcgcgcggcataatatttcggtagac
ttaatcaccacgtcagaagtgagcgtggcattaacccttgataccaccggttcaacctcc
actggcgatacgttgctgacgcaatctctgctgatggagctttccgcactgtgtcgggtg
gaggtggaagaaggtctggcgctggtcgcgttgattggcaatgacctgtcaaaagcctgc
ggcgttggcaaagaggtattcggcgtactggaaccgttcaacattcgcatgatttgttat
ggcgcatccagccataacctgtgcttcctggtgcccggcgaagatgccgagcaggtggtg
caaaaactgcatagtaatttgtttgagtaa

DBGET integrated database retrieval system