KEGG   Escherichia coli K-12 MG1655: b4029Help
Entry
b4029             CDS       T00007                                 

Gene name
yjbH
Definition
(RefSeq) DUF940 family extracellular polysaccharide protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbH
Motif
Other DBs
NCBI-GeneID: 948527
NCBI-ProteinID: NP_418453
Pasteur: yjbH
RegulonDB: ECK120001854
ECOCYC: EG11926
ASAP: ABE-0013176
UniProt: P32689
Position
4237634..4239730
Genome map
AA seq 698 aa AA seqDB search
MKKRHLLSLLALGISTACYGETYPAPIGPSQSDFGGVGLLQTPTARMAREGELSLNYRDN
DQYRYYSASVQLFPWLETTLRYTDVRTRQYSSVEAFSGDQTYKDKAFDLKLRLWEESYWL
PQVAVGARDIGGTGLFDAEYLVASKAWGPFDFTLGLGWGYLGTSGNVKNPLCSASDKYCY
RDNSYKQAGSIDGSQMFHGPASLFGGVEYQTPWQPLRLKLEYEGNNYQQDFAGKLEQKSK
FNVGAIYRVTDWADVNLSYERGNTFMFGVTLRTNFNDLRPSYNDNARPQYQPQPQDAILQ
HSVVANQLTLLKYNAGLADPQIQAKGDTLYVTGEQVKYRDSREGIIRANRIVMNDLPDGI
KTIRITENRLNMPQVTTETDVASLKNHLAGEPLGHETTLAQKRVEPVVPQSTEQGWYIDK
SRFDFHIDPVLNQSVGGPENFYMYQLGVMGTADLWLTDHLLTTGSLFANLANNYDKFNYT
NPPQDSHLPRVRTHVREYVQNDVYVNNLQANYFQHLGNGFYGQVYGGYLETMFGGAGAEV
LYRPLDSNWAFGLDANYVKQRDWRSAKDMMKFTDYSVKTGHLTAYWTPSFAQDVLVKASV
GQYLAGDKGGTLEIAKRFDSGVVVGGYATITNVSKEEYGEGDFTKGVYVSVPLDLFSSGP
TRSRAAIGWTPLTRDGGQQLGRKFQLYDMTSDRSVNFR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagacatctgcttagcttactggcgctgggcattagcacagcttgctacggc
gaaacatatcctgcgcccattggtccgtcgcagtcggatttcggtggcgtaggattatta
caaacgcccaccgcgcgtatggcacgggaaggggagttgagtctgaactatcgcgataac
gatcagtaccgttattactcagcttcagtgcaactcttcccgtggctggaaacaacgctg
cgctacaccgacgtgcgcacccggcagtacagcagcgtcgaagcgttctctggcgatcaa
acgtataaagataaagccttcgatctcaaactgcgtttgtgggaagagagttactggctg
ccgcaagtggcggttggtgcgcgggatatcggcggtacggggctgtttgatgcggaatat
cttgttgccagcaaagcctgggggccgttcgattttacgctcggcctgggctgggggtat
ttgggcaccagcggtaatgtgaaaaatccgctctgttcagccagtgataaatattgctat
cgcgataacagctacaaacaggcgggatctatcgacggtagccagatgttccacggtcct
gcctcactgtttggcggcgtggaataccagacgccctggcaaccgctgcgcctgaaactg
gagtatgaaggcaataattatcagcaggattttgccgggaagctggagcaaaaaagtaag
tttaacgtcggtgcgatttatcgcgttaccgattgggccgacgttaaccttagctatgaa
cgtggcaacacctttatgtttggcgttacgttgcgcaccaactttaacgatctgcgcccg
tcttacaacgataacgcccgcccgcaatatcaaccgcagccgcaggatgccattttgcag
cattcggtggtggcgaatcagttaacgctgttgaaatacaatgccggacttgccgatcca
cagatccaggcgaaaggcgatacgctgtatgttaccggcgagcaggtgaaatatcgtgat
tcgcgcgaagggatcatccgtgcgaatcggatcgtgatgaacgatctgccggatgggatc
aaaacgatccgcattacggaaaatcgccttaacatgccgcaggtgacgacggaaaccgat
gtcgccagcctgaaaaatcatctcgccggagagccgttgggccacgaaacgacgctggcg
caaaaacgcgtcgagccagtggttccgcagtccaccgagcagggctggtatatcgacaaa
tcacgctttgatttccatatcgatccggtgctgaaccagtcggtcggtggcccggaaaac
ttttacatgtatcagctgggcgtgatgggaacggcagatttgtggctgacggaccatctg
ctgaccaccggcagcctgtttgcaaatcttgccaacaactacgacaagtttaactacact
aatcctccgcaggactcgcacttaccgcgcgtgcgtacccatgtgcgcgagtatgtgcag
aacgatgtctatgtgaataacctgcaagccaactacttccagcatctgggcaacggcttc
tacggtcaggtctacggtggttatctcgaaaccatgtttggcggtgcgggggcagaagtg
ttgtatcgcccgctggacagcaactgggcgtttggtctggatgccaactacgttaaacag
cgcgactggcgtagtgcaaaagatatgatgaaattcaccgactacagcgtgaaaaccgga
catctgaccgcctactggacgccatctttcgctcaggatgtgttagttaaagccagcgtc
gggcagtatctggcaggggataaaggcggcacgctggagatcgccaaacgctttgatagc
ggcgtggtggtgggtggctatgccacgatcactaatgtttcgaaagaggagtacggcgaa
ggggacttcaccaaaggcgtgtatgtctcggtaccgttggatctcttctcgtctggcccg
acacgcagccgtgcggcgattggctggacgccgctgacgcgtgacggtggtcagcaactt
gggcgtaagttccagttgtatgacatgaccagcgaccgtagcgtcaatttccgctaa

DBGET integrated database retrieval system