KEGG   Escherichia coli K-12 MG1655: b4032Help
Entry
b4032             CDS       T00007                                 

Gene name
malG
Definition
(RefSeq) maltose ABC transporter membrane subunit MalG
  KO
K10110  maltose/maltodextrin transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4032 (malG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4032 (malG)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    b4032 (malG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OATP
Motif
Other DBs
NCBI-GeneID: 948530
NCBI-ProteinID: NP_418456
Pasteur: malG
RegulonDB: ECK120000549
ECOCYC: EG10556
ASAP: ABE-0013193
UniProt: P68183
Structure
PDB: 

Position
complement(4242626..4243516)
Genome map
AA seq 296 aa AA seqDB search
MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK
LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT
LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY
FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV
NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggtccaaccgaaatcgcaaaaagctcgtttatttattactcacctgctactg
ctactttttatcgcagcgattatgttcccgctgctgatggtcgtcgctatctcgctgcgt
cagggaaactttgcgaccggcagcctgatcccggagcaaatctcctgggatcactggaaa
ctggcgttaggttttagcgttgaacaggctgatggtcgcattacgccaccgccattcccg
gtactgctgtggctgtggaactcggtaaaggtcgccgggatttccgcgattggcattgtg
gcgctctccaccacctgcgcctacgctttcgcccgtatgcgctttccaggcaaagcgacg
ctgctgaaaggaatgctgattttccagatgttcccggcagtactttcactggtcgcgttg
tatgcgttgtttgatcgtctgggtgagtacattccattcattggcctgaatactcacggc
ggcgtaattttcgcgtatctgggtgggattgcgctgcatgtctggaccatcaaaggctat
ttcgaaaccatcgacagttcgctggaagaagctgctgcgctggatggtgcgacaccgtgg
caggccttccgccttgtcctgttgccgctgtcagtaccgattctggcggtggtattcatc
ctgtcgtttatcgctgccattactgaagttccggtcgcgtcgctgttactgcgtgacgta
aacagctacaccctggccgtggggatgcagcaatacctcaacccgcaaaactacctgtgg
ggtgactttgccgccgctgccgtgatgtctgcattaccgatcaccatcgtcttcttgctg
gctcaacgctggctggtcaacggcctgacggcaggtggtgtgaaaggttaa

DBGET integrated database retrieval system