KEGG   Escherichia coli K-12 MG1655: b4034Help
Entry
b4034             CDS       T00007                                 

Gene name
malE
Definition
(RefSeq) maltose transporter subunit
  KO
K10108  maltose/maltodextrin transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02030  Bacterial chemotaxis
Module
eco_M00194  Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4034 (malE)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    b4034 (malE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4034 (malE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    b4034 (malE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6
Motif
Other DBs
NCBI-GeneID: 948538
NCBI-ProteinID: NP_418458
Pasteur: malE
RegulonDB: ECK120000547
ECOCYC: EG10554
ASAP: ABE-0013200
UniProt: P0AEX9
Structure
PDB: 

Position
complement(4245229..4246419)
Genome map
AA seq 396 aa AA seqDB search
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaacaggtgcacgcatcctcgcattatccgcattaacgacgatgatgttt
tccgcctcggctctcgccaaaatcgaagaaggtaaactggtaatctggattaacggcgat
aaaggctataacggtctcgctgaagtcggtaagaaattcgagaaagataccggaattaaa
gtcaccgttgagcatccggataaactggaagagaaattcccacaggttgcggcaactggc
gatggccctgacattatcttctgggcacacgaccgctttggtggctacgctcaatctggc
ctgttggctgaaatcaccccggacaaagcgttccaggacaagctgtatccgtttacctgg
gatgccgtacgttacaacggcaagctgattgcttacccgatcgctgttgaagcgttatcg
ctgatttataacaaagatctgctgccgaacccgccaaaaacctgggaagagatcccggcg
ctggataaagaactgaaagcgaaaggtaagagcgcgctgatgttcaacctgcaagaaccg
tacttcacctggccgctgattgctgctgacgggggttatgcgttcaagtatgaaaacggc
aagtacgacattaaagacgtgggcgtggataacgctggcgcgaaagcgggtctgaccttc
ctggttgacctgattaaaaacaaacacatgaatgcagacaccgattactccatcgcagaa
gctgcctttaataaaggcgaaacagcgatgaccatcaacggcccgtgggcatggtccaac
atcgacaccagcaaagtgaattatggtgtaacggtactgccgaccttcaagggtcaacca
tccaaaccgttcgttggcgtgctgagcgcaggtattaacgccgccagtccgaacaaagag
ctggcgaaagagttcctcgaaaactatctgctgactgatgaaggtctggaagcggttaat
aaagacaaaccgctgggtgccgtagcgctgaagtcttacgaggaagagttggcgaaagat
ccacgtattgccgccaccatggaaaacgcccagaaaggtgaaatcatgccgaacatcccg
cagatgtccgctttctggtatgccgtgcgtactgcggtgatcaacgccgccagcggtcgt
cagactgtcgatgaagccctgaaagacgcgcagactcgtatcaccaagtaa

DBGET integrated database retrieval system