KEGG   Escherichia coli K-12 MG1655: b4040Help
Entry
b4040             CDS       T00007                                 

Gene name
ubiA
Definition
(RefSeq) p-hydroxybenzoate octaprenyltransferase
  KO
K03179  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00130  Ubiquinone and other terpenoid-quinone biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b4040 (ubiA)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     b4040 (ubiA)
Prenyltransferases [BR:eco01006]
 Compound prenylation
  4HB prenyltransferase
   b4040 (ubiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-GeneID: 948540
NCBI-ProteinID: NP_418464
Pasteur: ubiA
RegulonDB: ECK120001338
ECOCYC: EG11370
ASAP: ABE-0013229
UniProt: P0AGK1
Position
4253016..4253888
Genome map
AA seq 290 aa AA seqDB search
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR
AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL
LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA
VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY
WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagtggagtctgacgcagaataagctgctggcgtttcatcgcttaatgcgtacggat
aagccaattggcgcgttactgctgctctggccaacattatgggcgttgtgggtggcgaca
ccgggcgttccccagctctggatcctggcggtgtttgtcgcgggtgtctggctgatgcgc
gctgccggatgtgtggtgaatgattatgctgaccgcaagtttgatggtcatgttaagcgc
acggcgaaccgaccacttcccagcggcgcggtaacagagaaagaggcgcgcgcgctgttt
gtcgtgctggtactgatttcgtttttactggtgctgacgctgaatacgatgaccattctg
ttgtcgattgccgcgctagcgctggcgtgggtgtacccgtttatgaagcggtatacccat
ctaccgcaagtggtgctgggcgcggcgtttggctggtcgattccaatggcttttgccgct
gtgagtgagtcggtgccattgagttgctggttaatgttcctcgccaatattctctgggcg
gtggcttacgacacgcagtatgcgatggttgaccgcgatgatgatgtgaagattggcatt
aaatccacggcaatcctgttcggccaatacgataaattgattattggtattttgcagatt
ggcgtactggcactgatggcgatcatcggtgagttaaatggcttaggctggggatattac
tggtcaattctggtggctggcgcgctgtttgtttatcaacaaaaactgattgccaaccgc
gagcgtgaagcctgctttaaagcatttatgaataataactatgttggtctggtactattt
ttagggctggcaatgagttactggcatttctga

DBGET integrated database retrieval system