KEGG   Escherichia coli K-12 MG1655: b4041Help
Entry
b4041             CDS       T00007                                 

Gene name
plsB
Definition
(RefSeq) glycerol-3-phosphate O-acyltransferase
  KO
K00631  glycerol-3-phosphate O-acyltransferase [EC:2.3.1.15]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00561  Glycerolipid metabolism
eco00564  Glycerophospholipid metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    b4041 (plsB)
   00564 Glycerophospholipid metabolism
    b4041 (plsB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eco01004]
    b4041 (plsB)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     b4041 (plsB)
Lipid biosynthesis proteins [BR:eco01004]
 Phospholipid acyltransferase
  GPAT
   b4041 (plsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 948541
NCBI-ProteinID: NP_418465
Pasteur: plsB
RegulonDB: ECK120000731
ECOCYC: EG10740
ASAP: ABE-0013232
UniProt: P0A7A7
Position
complement(4254043..4256466)
Genome map
AA seq 807 aa AA seqDB search
MSGWPRIYYKLLNLPLSILVKSKSIPADPAPELGLDTSRPIMYVLPYNSKADLLTLRAQC
LAHDLPDPLEPLEIDGTLLPRYVFIHGGPRVFTYYTPKEESIKLFHDYLDLHRSNPNLDV
QMVPVSVMFGRAPGREKGEVNPPLRMLNGVQKFFAVLWLGRDSFVRFSPSVSLRRMADEH
GTDKTIAQKLARVARMHFARQRLAAVGPRLPARQDLFNKLLASRAIAKAVEDEARSKKIS
HEKAQQNAIALMEEIAANFSYEMIRLTDRILGFTWNRLYQGINVHNAERVRQLAHDGHEL
VYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAGPIFRRLGAFFIRRTFKGNK
LYSTVFREYLGELFSRGYSVEYFVEGGRSRTGRLLDPKTGTLSMTIQAMLRGGTRPITLI
PIYIGYEHVMEVGTYAKELRGATKEKESLPQMLRGLSKLRNLGQGYVNFGEPMPLMTYLN
QHVPDWRESIDPIEAVRPAWLTPTVNNIAADLMVRINNAGAANAMNLCCTALLASRQRSL
TREQLTEQLNCYLDLMRNVPYSTDSTVPSASASELIDHALQMNKFEVEKDTIGDIIILPR
EQAVLMTYYRNNIAHMLVLPSLMAAIVTQHRHISRDVLMEHVNVLYPMLKAELFLRWDRD
ELPDVIDALANEMQRQGLITLQDDELHINPAHSRTLQLLAAGARETLQRYAITFWLLSAN
PSINRGTLEKESRTVAQRLSVLHGINAPEFFDKAVFSSLVLTLRDEGYISDSGDAEPAET
MKVYQLLAELITSDVRLTIESATQGEG
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctggccacgaatttactacaaattactgaatttaccattaagcatcctggta
aaaagcaagtctattccggcagatcctgccccggaactggggctggatacctctcgtcca
attatgtacgttttaccgtacaactcgaaagcagatttgctgacgttgcgcgcccagtgt
ctggcacatgacttgcctgacccgttagagccgctggaaatcgacggcacgctactgccg
cgctatgtgttcattcacggcgggccgcgtgtgttcacctattacacgccgaaagaagag
tctattaagctgttccacgactatctcgatttgcaccgtagcaacccaaatctggatgtg
cagatggtgccagtgtcggtgatgtttggtcgcgcgccggggcgtgaaaaaggcgaagtg
aacccgccgctgcgtatgcttaacggcgtacagaaatttttcgctgtactgtggctcggt
cgcgacagttttgtgcgtttctcgccgtcagtttcgctgcgccgtatggcggatgaacac
ggcacggataaaactatcgctcagaaactggcgcgcgtggcgcgtatgcactttgcccgt
caacgtctggctgccgtaggcccacgtttgcctgctcgtcaggatctgtttaataagctg
ctcgcctcccgcgccattgccaaagcggtagaagatgaagcgcgcagcaaaaaaatctcc
catgaaaaagcgcagcagaacgcgattgcactgatggaagagattgcggcgaatttctct
tacgagatgattcgcctgactgaccgtattctgggcttcacctggaaccgactttaccag
ggcatcaacgtccataacgctgagcgcgttcgccagctggcccacgacggtcatgagctg
gtatatgtgccttgccaccgcagtcacatggactacctgctgctttcttacgtgctgtat
caccaggggctggtgccgccgcatatcgccgccgggatcaacctgaatttctggcctgcc
gggccgattttccgccgtctgggggcgttctttattcgccgtacgtttaaaggcaataaa
ctttattccaccgttttccgggagtatctcggcgaactgttcagccgtggttattccgtc
gagtacttcgtggaaggcggtcgttcccgtacggggcgtttgctggatccgaaaactggt
acgctgtcgatgaccattcaggcgatgctgcgtggcggcacgcgtccgattacgctgatt
ccgatctatatcggttatgagcacgtcatggaagtgggtacttacgccaaagaactgcgc
ggcgcgacgaaagagaaagagagcctgccgcagatgctgcgcggtttaagcaagctgcgt
aatctcggtcagggttacgtcaacttcggtgaaccaatgccgttgatgacctaccttaac
cagcatgtacctgactggcgtgaatctatcgatcccatcgaagcggtgcgtccggcatgg
ttaacgccgacggtcaataatattgctgccgatctgatggtacgcattaacaacgcaggc
gcggcaaacgccatgaacctgtgctgtactgcgctactggcatcacgtcagcgctcactc
acccgcgagcagttaaccgagcaactcaactgctacctggatctgatgcgcaacgtgccc
tactccacggactctaccgttccttcagccagcgccagcgagcttatcgatcacgcgctg
caaatgaacaagtttgaagtcgagaaagacacaatcggcgacatcatcattctgccgcgc
gagcaagcggtgctgatgacctactatcgcaacaacattgcgcatatgttggtgctgcct
tcgctgatggcggcaatcgtcacccagcatcgccacatctcccgcgacgtattgatggag
cacgtcaatgtgctttacccaatgctgaaagcggagctgttcctgcgctgggatcgcgac
gagttgccggacgttattgatgcgctggcaaatgagatgcaacgtcaggggctgattacc
ctgcaagatgatgagttgcatatcaacccggcgcattctcgcacgctacagctgctggcc
gcaggcgcgcgcgaaacgctgcaacgttatgccatcaccttctggttgttgagtgccaac
ccgtcgatcaaccgcggtacgctggagaaagagagccgcaccgtcgcgcaacgtctctcc
gtgctgcacggcatcaacgcgccggagttcttcgacaaggcggtgttcagttctctggtg
ctgacactgcgtgatgaagggtatatcagcgatagcggcgatgccgaaccggcagaaacg
atgaaggtttatcagttgctggcggagttgattacatcagacgtgcgtttgacgattgag
agtgcgacgcagggcgaagggtaa

DBGET integrated database retrieval system