KEGG   Escherichia coli K-12 MG1655: b4053Help
Entry
b4053             CDS       T00007                                 

Gene name
alr
Definition
(RefSeq) alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00473  D-Alanine metabolism
eco01100  Metabolic pathways
eco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    b4053 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    b4053 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
    b4053 (alr)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     b4053 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Precursor biosynthesis
  Racemase
   b4053 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 948564
NCBI-ProteinID: NP_418477
Pasteur: alr
RegulonDB: ECK120000001
ECOCYC: EG10001
ASAP: ABE-0013272
UniProt: P0A6B4
Structure
PDB: 

Position
4265782..4266861
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcccctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtactgttactcgaaggc
ttttttgatgccagagatctgccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgcctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgtggcgcaaccgagaaacaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcgtcgggtggcattctgctgtgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttatggcgtctcgccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcactaacctccagc
ctgattgccgtgcgtgagcataaagccggagagcctgttggttatggtggaacctgggta
agcgaacgtgatacccgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtaccgattgtcgggcgc
gtggcgatggatatgatctgcgtagacttaggtccacaggcgcaggacaaagccggggat
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agcgcttacgaacttattacgcgcctgacttcaagggtcgcgatgaaatacgtggattaa

DBGET integrated database retrieval system