KEGG   Escherichia coli K-12 MG1655: b4062Help
Entry
b4062             CDS       T00007                                 

Gene name
soxS
Definition
(RefSeq) superoxide response regulon transcriptional activator; autoregulator
  KO
K13631  AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b4062 (soxS)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    b4062 (soxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 948567
NCBI-ProteinID: NP_418486
Pasteur: soxS
RegulonDB: ECK120000947
ECOCYC: EG10958
ASAP: ABE-0013311
UniProt: P0A9E2
Position
complement(4277060..4277383)
Genome map
AA seq 107 aa AA seqDB search
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLL
LAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTPSDYRHRL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcagaaaattattcaggatcttatcgcatggattgacgagcatattgaccag
ccgcttaacattgatgtagtcgcaaaaaaatcaggctattcaaagtggtacttgcaacga
atgttccgcacggtgacgcatcagacgcttggcgattacattcgccaacgccgcctgtta
ctggccgccgttgagttgcgcaccaccgagcgtccgatttttgatatcgcaatggacctg
ggttatgtctcgcagcagaccttctcccgcgttttccgtcggcagtttgatcgcactccc
agcgattatcgccaccgcctgtaa

DBGET integrated database retrieval system