KEGG   Escherichia coli K-12 MG1655: b4063Help
Entry
b4063             CDS       T00007                                 

Gene name
soxR
Definition
(RefSeq) redox-sensitive transcriptional activator of soxS; autorepressor
  KO
K13639  MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b4063 (soxR)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   MerR family
    b4063 (soxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR-DNA-bind MerR MerR_1 HTH_3 DUF2670
Motif
Other DBs
NCBI-GeneID: 948566
NCBI-ProteinID: NP_418487
Pasteur: soxR
RegulonDB: ECK120000946
ECOCYC: EG10957
ASAP: ABE-0013316
UniProt: P0ACS2
Structure
PDB: 

Position
4277469..4277933
Genome map
AA seq 154 aa AA seqDB search
MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII
KIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCI
GCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaattaccccgcattaaagcgctgctaacccccggcgaagtggcgaaacgc
agcggtgtggcggtatcggcgctgcatttctatgaaagtaaagggttgattaccagtatc
cgtaacagcggcaatcagcggcgatataaacgtgatgtgttgcgatatgttgcaattatc
aaaattgctcagcgtattggcattccgctggcgaccattggtgaagcgtttggcgtgttg
cccgaagggcatacgttaagtgcgaaagagtggaaacagctttcgtcccaatggcgagaa
gagttggatcggcgcattcataccttagtggcgctgcgtgacgaactggacggatgtatt
ggttgtggctgcctttcgcgcagtgattgcccgttgcgtaacccgggcgaccgcttagga
gaagaaggtaccggcgcacgcttgctggaagatgaacaaaactaa

DBGET integrated database retrieval system