KEGG   Escherichia coli K-12 MG1655: b4068Help
Entry
b4068             CDS       T00007                                 

Gene name
yjcH
Definition
(RefSeq) DUF485 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF485 SKG6 MASE3 FA_desaturase DUF2207
Motif
Other DBs
NCBI-GeneID: 948574
NCBI-ProteinID: NP_418492
Pasteur: yjcH
RegulonDB: ECK120001871
ECOCYC: EG11943
ASAP: ABE-0013330
UniProt: P0AF54
Position
complement(4284899..4285213)
Genome map
AA seq 104 aa AA seqDB search
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS
VTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcactatttatcagcggatagaagacaatgcgcatttcagggagttagtcgaa
aaacggcaacggtttgccaccatcctgtcgattattatgctggcagtttatatcggcttt
attttactgatcgccttcgcgcccggctggctgggcacgccgctgaatccgaacaccagc
gtcacacgcggtattccaattggtgttggagtgattgtgatctcctttgttctcaccggt
atctacatctggcgggcgaacggcgaattcgaccgtcttaataatgaagtcctgcatgag
gtacaagcatcatga

DBGET integrated database retrieval system