KEGG   Escherichia coli K-12 MG1655: b4076
Entry
b4076             CDS       T00007                                 

Gene name
nrfG
Definition
(RefSeq) putative formate-dependent nitrite reductase complex subunit NrfG
  KO
K04018  formate-dependent nitrite reductase complex subunit NrfG
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    b4076 (nrfG)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_17 ANAPC3 TPR_12 TPR_14 ChAPs Pept_S41_N TPR_20
Other DBs
NCBI-GeneID: 948592
NCBI-ProteinID: NP_418500
Pasteur: nrfG
RegulonDB: ECK120001877
ECOCYC: EG11950
ASAP: ABE-0013354
UniProt: P32712
Structure
PDB: 
2E2E

Position
4293543..4294139
AA seq 198 aa
MKQPKIPVKMLTTLTILMVFLCVGSYLLSPKWQAVRAEYQRQRDPLHQFASQQTPEAQLQ
ALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQ
ASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRVNR
TQLVESINMAKLLQRRLD
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaacagcccaaaataccggtgaaaatgctgacaacactcacgatattgatggtattt
ctctgtgtcggcagttatctgttaagcccaaaatggcaggcggtacgtgcggagtatcag
cgtcagcgcgatccgctacatcagtttgccagccagcaaaccccggaagcgcagcttcag
gcattgcaggataaaatccgcgctaatccacaaaacagcgaacagtgggcgttactgggc
gagtactatctgtggcaaaacgattacagcaattcgttgctggcgtaccgtcaggcgttg
caactacgtggtgagaacgctgaactgtatgcggcgctggcgacggtgctttattaccag
gccagccagcatatgaccgcccagactcgcgcaatgatcgacaaagccctcgcgctggac
agtaatgaaatcaccgccctgatgctgctggcttccgatgcgtttatgcaggcgaactac
gcgcaagccatcgaactatggcaaaaagtgatggatctcaactcaccgcgagttaaccga
acacagctggttgagtcgattaatatggcgaaattgttgcagcggagattggattaa

DBGET integrated database retrieval system