KEGG   Escherichia coli K-12 MG1655: b4077Help
Entry
b4077             CDS       T00007                                 

Gene name
gltP
Definition
(RefSeq) glutamate/aspartate:proton symporter
  KO
K11102  proton glutamate symport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4077 (gltP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF
Motif
Other DBs
NCBI-GeneID: 948591
NCBI-ProteinID: NP_418501
Pasteur: gltP
RegulonDB: ECK120000398
ECOCYC: EG10405
ASAP: ABE-0013357
UniProt: P21345
Position
4294481..4295794
Genome map
AA seq 437 aa AA seqDB search
MKNIKFSLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIV
ISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATV
DISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPAT
HREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFA
ILFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSI
TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGV
SFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKA
LAYEREVLGKFDKTADQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaaattcagcctggcctggcagattctgtttgctatggtgctgggcatt
ctcctgggaagctacctgcactaccatagcgacagccgcgactggctggtcgtcaatttg
ctctctccggcgggtgatatcttcatccatctgattaaaatgattgttgtgccgattgtg
atctccacgctggtggtgggtatcgcgggtgttggtgatgccaaacagctcgggcgtatt
ggcgcgaaaaccattatctacttcgaggtgatcaccaccgtcgccatcattttggggatc
actctggcgaacgtcttccagcccggtgccggggtggatatgtcgcagttggcgaccgtc
gatatctcgaaatatcagagcactacggaagcggtacaaagcagttcccacggcattatg
ggcacgattttgtcgctggtgccgacgaacattgtggcgtcgatggcgaaaggcgaaatg
ctgccgatcatctttttctcggtgctgtttggtctggggctttcttccctgcccgcgacg
catcgtgaaccgctggtgaccgtgttccgctccatctctgaaaccatgtttaaagtgact
cacatggtgatgcgttatgcaccggtgggtgtgtttgcgctgattgcggtgacggtggct
aactttggtttctcgtctctgtggccactggcgaaactggtgctgctggtgcatttcgcc
attctgttcttcgcgctggtagtgctgggaattgtggcgcgcctgtgcgggttaagcgtc
tggatcctgattcgtattctgaaagatgagctgattctggcgtactccactgccagctct
gaaagcgtgctgccgcgaattattgagaagatggaagcctacggagcaccggtgtcgatc
accagtttcgtggtgccgaccggttactcttttaaccttgatggttcgacgctgtatcaa
agtattgccgctatcttcatcgcgcagttgtatggcattgacctgtccatctggcaggaa
atcattctggtgctgacgctgatggtgacctcgaaagggattgctggcgtgcctggcgtg
tcgtttgtggtgttgctggcaacgctgggtagcgtaggtattccgctggaaggtctggcg
tttattgctggtgttgaccgtatcctcgacatggcgcgtactgcgctgaacgtggtgggt
aatgcgctggcggtgctggtgattgccaagtgggaacacaaatttgaccgtaagaaagcg
ctggcttatgagcgtgaagtgctgggcaaatttgataaaactgcggatcaataa

DBGET integrated database retrieval system