KEGG   Escherichia coli K-12 MG1655: b4089Help
Entry
b4089             CDS       T00007                                 

Gene name
alsR
Definition
(RefSeq) d-allose-inducible als operon transcriptional repressor; autorepressor; repressor of rpiR
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 SIS_2 BMC IF3_N DUF2529
Motif
Other DBs
NCBI-GeneID: 948603
NCBI-ProteinID: NP_418513
Pasteur: rpiR
RegulonDB: ECK120004319
ASAP: ABE-0013400
UniProt: P0ACS7
Position
complement(4312101..4312991)
Genome map
AA seq 296 aa AA seqDB search
MSQSEFDSALPNGIGLAPYLRMKQEGMTENESRIVEWLLKPGNLSCAPAIKDVAEALAVS
EAMIVKVSKLLGFSGFRNLRSALEDYFSQSEQVLPSELAFDEAPQDVVNKVFNITLRTIM
EGQSIVNVDEIHRAARFFYQARQRDLYGAGGSNAICADVQHKFLRIGVRCQAYPDAHIMM
MSASLLQEGDVVLVVTHSGRTSDVKAAVELAKKNGAKIICITHSYHSPIAKLADYIICSP
APETPLLGRNASARILQLTLLDAFFVSVAQLNIEQANINMQKTGAIVDFFSPGALK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtcagagtttgattcagcgcttccgaacggtatagggttagcgccttacctg
cgaatgaagcaggaaggaatgacagaaaatgaaagccgcatcgtggagtggttactcaaa
cccggtaacctgagttgtgcacccgcaattaaagatgtcgcagaagctctggcggtatct
gaagcgatgatagttaaggtatcaaagctgctggggtttagcggctttcgtaacttacgc
agtgcgctggaagattatttttctcagtcagaacaggtattgccttccgagttggctttt
gatgaagcgccgcaggatgtggtgaataaggtatttaacatcactttacgcaccattatg
gaaggtcagtcgatcgtcaacgttgatgagatccaccgtgccgcccgctttttctatcag
gccagacagcgggatttgtacggtgccggaggatcaaatgctatctgtgctgatgtacag
cacaagttcttgcgcattggcgtacgctgtcaggcctatcctgatgctcacatcatgatg
atgtccgcttcgttgttacaggaaggagatgttgtgctggtagtgacccattccgggcga
accagtgatgtaaaagcggccgtagaactggcaaaaaagaacggggcaaagattatttgt
ataacccatagctaccattcaccgatagcgaaactggccgattatattatttgctcacca
gccccggaaacgccgttattaggtcgtaatgcctcggcaagaatattacaactaactttg
ctggacgctttttttgtctctgtcgcccagctcaacattgaacaagctaatattaatatg
caaaaaaccggcgcaattgttgatttcttctcaccaggcgcgctgaaataa

DBGET integrated database retrieval system