KEGG   Escherichia coli K-12 MG1655: b4096
Entry
b4096             CDS       T00007                                 

Gene name
phnL
Definition
(RefSeq) methylphosphonate degradation complex subunit PhnL
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00440  Phosphonate and phosphinate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    b4096 (phnL)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     b4096 (phnL)
SSDB
Motif
Pfam: ABC_tran AAA_16 SMC_N AAA_21 AAA_22 AAA_33 AAA_29 RsgA_GTPase NACHT AAA_30 AAA_25 TsaE SbcCD_C Viral_helicase1 VirE FtsK_SpoIIIE DUF815 Septin AAA_23 AAA_14 AAA_7 RNA_helicase MMR_HSR1 NB-ARC cobW SIS_2 Gtr1_RagA
Other DBs
NCBI-GeneID: 948612
NCBI-ProteinID: NP_418520
Pasteur: phnL
RegulonDB: ECK120000713
ECOCYC: EG10721
ASAP: ABE-0013421
UniProt: P16679
Position
complement(4317215..4317895)
AA seq 226 aa
MINVQNVSKTFILHQQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLP
DEGQIQIKHGDEWVDLVTAPARKVVEIRKTTVGWVSQFLRVIPRISALEVVMQPLLDTGV
PREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASL
DAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGASS
NT seq 681 nt   +upstreamnt  +downstreamnt
atgattaacgtacaaaacgtcagtaaaaccttcatcctgcaccagcaaaacggcgtgcgc
ctgcccgtcctcaatcgcgcctcgctcaccgtcaacgcgggcgaatgcgtggtgctccac
ggccattccggcagcggcaaatcaactctgctacgctcgctgtacgccaactatctgccc
gacgaaggtcaaatccagatcaaacacggtgacgagtgggtagacctggtcaccgcgcca
gcgcgcaaagtggtggaaatccgcaaaaccaccgtcggctgggtgagccagtttctgcgc
gtcatcccgcgtatctcagcactggaagtggtgatgcagccgctgctcgataccggcgtt
ccgcgtgaagcctgcgccgctaaagccgcgcgtcttctcacccgcctgaacgtgccggaa
cgcctgtggcacctggcaccatcgacattttccggtggcgaacagcagcgcgtcaacatc
gcccgcggctttatcgtcgactaccccattctgctgcttgacgaacctaccgcctcgctg
gacgccaaaaacagcgccgcggtggtggaactgattcgcgaagccaaaacccgtggcgca
gccatcgtaggcatcttccatgacgaagctgtacgtaatgacgtcgccgaccgcctgcac
ccaatgggagcctcttcatga

DBGET integrated database retrieval system