KEGG   Escherichia coli K-12 MG1655: b4100
Entry
b4100             CDS       T00007                                 

Gene name
phnH
Definition
(RefSeq) carbon-phosphorus lyase core complex subunit PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00440  Phosphonate and phosphinate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    b4100 (phnH)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     b4100 (phnH)
SSDB
Motif
Pfam: PhnH DUF4092
Other DBs
NCBI-GeneID: 948619
NCBI-ProteinID: NP_418524
Pasteur: phnH
RegulonDB: ECK120000709
ECOCYC: EG10717
ASAP: ABE-0013430
UniProt: P16686
Structure
PDB: 
4XB6 2FSU

Position
complement(4320663..4321247)
AA seq 194 aa
MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDT
PVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAG
ATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTERPHPFPLGIDLILTCGE
RLLAIPRTTHVEVC
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaccctggaaaccgcttttatgcttcccgtgcaggatgcccagcacagttttcgtcgc
ctgttaaaggccatgagcgagccgggcgtgattgtcgccctgcatcagctcaaacgcggc
tggcaaccgctgaatatcgccaccaccagcgtgctgctgacgctggccgataacgacacg
ccggtgtggctttctaccccattaaataacgatatcgtcaaccagagcctgcgttttcat
accaacgcgccgctggtcagccagccggaacaggcgaccttcgcggtgacggatgaggcg
atttccagcgaacagctcaacgccctttccaccggcaccgccgttgcgccggaagcgggt
gcgacgctgattttacaggtcgccagcctgagcggcggacgcatgttgcgccttactggt
gcgggtattgccgaagaacgaatgatcgctccgcagctgccggagtgcattctgcacgaa
ctcaccgagcgcccgcatccgttcccgctcggcatcgacctgatcctgacctgtggcgag
cgcctgctggctattccgcgaaccactcatgtggaggtgtgctga

DBGET integrated database retrieval system