KEGG   Escherichia coli K-12 MG1655: b4105
Entry
b4105             CDS       T00007                                 

Gene name
phnD
Definition
(RefSeq) phosphonate ABC transporter periplasmic binding protein
  KO
K02044  phosphonate transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4105 (phnD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4105 (phnD)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    b4105 (phnD)
SSDB
Motif
Pfam: Phosphonate-bd SBP_bac_3 YukC NMT1_3
Other DBs
NCBI-GeneID: 948624
NCBI-ProteinID: NP_418529
Pasteur: phnD
RegulonDB: ECK120000706
ECOCYC: EG10714
ASAP: ABE-0013442
UniProt: P16682
Structure
PDB: 
3P7I 3QUJ 3QK6 3S4U

Position
complement(4323336..4324352)
AA seq 338 aa
MNAKIIASLAFTSMFSLSTLLSPAHAEEQEKALNFGIISTESQQNLKPQWTPFLQDMEKK
LGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYW
SVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVN
AGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLS
ETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQGVKSNKG
LNEQDKLAKTTEIQAQLDDLDRLNNALSAMSSVSKAVQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaacgctaagataattgcctcgctggccttcaccagcatgttcagcctcagcaccctg
ttaagcccggcgcacgccgaagagcaggaaaaggcgttgaatttcggcattatttcaacg
gaatcacagcaaaacctgaaaccgcaatggacgccgttcttgcaggatatggagaagaag
ctgggcgtgaaggtcaacgccttctttgccccggactacgcgggcattatccaggggatg
cgcttcaataaagtggatatcgcctggtacggcaatctgtcggcgatggaagcggtggat
cgcgccaatggccaggtcttcgcccagacggtcgcggcggatggatcgccgggttactgg
agcgtgttgatcgtcaacaaagacagtccgatcaacaacctgaacgatctgctggcgaag
cggaaagatctcacctttggcaatggcgatcctaactccacctctggcttcctcgtcccc
ggctactacgtcttcgccaaaaacaatatctccgccagcgacttcaagcgcaccgtcaac
gccgggcatgaaaccaacgcgctggccgtcgccaacaagcaggtggatgttgccaccaac
aacaccgaaaacctcgacaagctgaaaacctccgcgccagagaagctgaaagaactgaag
gtgatctggaagtcgccgctgatcccaggcgatccgatcgtctggcgcaagaatctttcc
gaaaccaccaaagacaagatctacgacttctttatgaactacggcaaaacgccggaagaa
aaagcggtgctggaacgcctgggctgggcgccattccgcgcttccagcgacctgcaactg
gtgccgattcgccagctcgcgctgtttaaagagatgcagggcgtgaaaagcaataaagga
ctgaatgagcaggacaagctggcaaaaaccaccgagattcaggcgcagctggatgacctg
gaccgcctgaacaacgcgctaagcgcgatgagttcggtgagtaaagcggtgcagtaa

DBGET integrated database retrieval system