KEGG   Escherichia coli K-12 MG1655: b4118
Entry
b4118             CDS       T00007                                 

Gene name
melR
Definition
(RefSeq) DNA-binding transcriptional dual regulator MelR
  KO
K23237  AraC family transcriptional regulator, melibiose operon regulatory protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b4118 (melR)
Transcription factors [BR:eco03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    b4118 (melR)
SSDB
Motif
Pfam: HTH_AraC HTH_18 Cupin_2 Bac_A_amyl_C
Other DBs
NCBI-GeneID: 948637
NCBI-ProteinID: NP_418542
Pasteur: melR
RegulonDB: ECK120001208
ECOCYC: EG11230
ASAP: ABE-0013486
UniProt: P0ACH8
Position
complement(4340720..4341628)
AA seq 302 aa
MNTDTFMCSSDEKQTRSPLSLYSEYQRMEIEFRAPHIMPTSHWHGQVEVNVPFDGDVEYL
INNEKVNINQGHITLFWACTPHQLTDTGTCQSMAIFNLPMHLFLSWPLDKDLINHVTHGM
VIKSLATQQLSPFEVRRWQQELNSPNEQIRQLAIDEIGLMLKRFSLSGWEPILVNKTSRT
HKNSVSRHAQFYVSQMLGFIAENYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYI
TAMRINHVRALLSDTDKSILDIALTAGFRSSSRFYSTFGKYVGMSPQQYRKLSQQRRQTF
PG
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaatacagatacgtttatgtgcagcagcgacgaaaaacagacccgcagcccgctgtcg
ctgtattcggaataccagcggatggagattgagtttcgcgcaccgcatatcatgcccacc
agccactggcatggtcaggtcgaagtgaatgtgcctttcgatggcgatgtggaatacctg
atcaacaatgaaaaagtgaatatcaatcagggtcatatcacgctgttctgggcctgtaca
ccgcaccaactaacagataccggaacctgtcagagcatggcgatttttaatctgccgatg
catctgtttctctcctggccgctggataaagacctgattaaccacgtcactcacggcatg
gtgatcaaatcactggccacacagcaacttagcccgtttgaagtgcgccgctggcagcag
gaattaaacagtccgaacgagcaaattcgccagctcgccattgatgaaattggcctgatg
ctcaagcgatttagcctctctggctgggaaccgattctggtcaataaaacctcgcgcaca
cacaaaaacagcgtctcgcgccatgcgcaattttatgttagccagatgctgggctttatt
gccgaaaactatgatcaggcgctgaccatcaacgatgtggctgagcacgtcaaacttaac
gccaactatgcaatggggatattccagcgggtcatgcaattgacgatgaaacagtacatt
accgcgatgcgcatcaaccacgttcgcgcgttactgagcgataccgataaaagtattctc
gatattgccctgacggcaggctttcgttcaagtagtcgtttttacagcacgttcggcaaa
tatgtcggcatgtcgccgcaacaataccgcaaacttagccaacagcgccgccagacgttt
cccggctaa

DBGET integrated database retrieval system