KEGG   Escherichia coli K-12 MG1655: b4125Help
Entry
b4125             CDS       T00007                                 

Gene name
dcuS
Definition
(RefSeq) sensory histidine kinase in two-component regulatory system with DcuR, regulator of anaerobic fumarate respiration
  KO
K07701  two-component system, CitB family, sensor histidine kinase DcuS [EC:2.7.13.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Module
eco_M00488  DcuS-DcuR (C4-dicarboxylate metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b4125 (dcuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eco01001]
    b4125 (dcuS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eco02022]
    b4125 (dcuS)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     b4125 (dcuS)
Protein kinases [BR:eco01001]
 Histidine kinases
  CitB family [OT]
   b4125 (dcuS)
Two-component system [BR:eco02022]
 CitB family
  DcuS-DcuR [MD:M00488]
   b4125 (dcuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c PAS SPOB_a HATPase_c_5 dCache_1 PAS_10 sCache_3_3 dCache_3 PAS_8 HATPase_c_2 PAS_9 PAS_4 HATPase_c_3 LrgB PAS_7
Motif
Other DBs
NCBI-GeneID: 948639
NCBI-ProteinID: NP_418549
Pasteur: dcuS
RegulonDB: ECK120004324
ECOCYC: G7827
ASAP: ABE-0013509
UniProt: P0AEC8
Structure
PDB: 

Position
complement(4350031..4351662)
Genome map
AA seq 543 aa AA seqDB search
MRHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVA
RTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPF
KGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSR
WSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDD
RGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRL
LLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILG
LLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSE
SQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGI
APDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGER
SNR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagacattcattgccctaccgcatgttacgcaaacgtccgatgaaattgagtaccaca
gtgatcttaatggtcagtgcggtactgttctcggtgctattggtggtgcatctgatttac
ttctcgcaaatcagtgatatgacgcgagatgggctagccaacaaggcactggcagtggcg
cgtaccctcgccgactcgccggaaatccgtcagggcttgcagaaaaaaccgcaggagagt
ggcatccaggccatcgcggaagccgtacgcaaacgcaacgatctgctgtttattgtcgtt
accgatatgcaaagtcttcgctactcgcatcctgaagcccagcgtattggtcagccattt
aaaggtgatgacatccttaaagcgctgaatggcgaagaaaatgtcgctatcaatcgcggt
tttctggcgcaggctttacgcgtatttacccccatctacgatgaaaatcataaacaaatt
ggcgtggtggcgatcggccttgagttaagccgtgtgacccaacagatcaatgacagtcgc
tggagcattatctggtcggtattatttggcatgctggtcggactgattggcacctgcatt
ctggttaaggtactgaaaaaaatccttttcggcctggaaccctacgaaatctccacgctg
tttgagcaacgccaggccatgttgcagtctatcaaagaaggcgtcgttgccgtggacgat
cgcggcgaggtcacgctgatcaacgatgccgcacaagaattgctgaattaccgtaagtcg
caggacgatgagaaactgtcgacgctaagccactcatggtcacaggtggtagatgtctcg
gaagtgttacgcgacggtaccccgcgccgcgacgaagagattacgattaaagaccggcta
ttactgatcaacaccgttccggtgcgcagtaatggcgttatcatcggtgccatttcaacc
ttcagggacaaaactgaagtacgtaaactgatgcagcgactcgacggtctggtcaactat
gctgacgcacttcgtgaacgatcccacgaatttatgaataaattgcatgtgattctcgga
ttattgcatctgaagagttataagcagttggaagattacattctcaaaacagccaataac
tatcaggaagagattggctctctgctgggtaagatcaaatctccggttatcgctggtttt
ttaatcagcaagattaaccgcgcgaccgatttaggccatacgctgattttaaacagtgaa
agccagctgccagacagcggcagtgaggaccaggtcgcgacgctgattaccacgttggga
aatctgatagaaaacgcgctggaggcattagggccggaacccggaggcgaaattagcgta
acattgcactaccgtcacggctggctgcactgtgaagttaatgatgatggaccggggatc
gcacccgataaaatcgatcacatttttgacaaaggtgtctcgacaaaaggaagcgagcga
ggcgtcggtttagcacttgtcaaacaacaggtagaaaatctcggcggcagcatcgccgtg
gaatcggaacccgggattttcacacaattttttgtccagataccctgggacggggagagg
tcgaacagatga

DBGET integrated database retrieval system