KEGG   Escherichia coli K-12 MG1655: b4141
Entry
b4141             CDS       T00007                                 

Symbol
yjeH
Name
(RefSeq) L-methionine/branched chain amino acid exporter
  KO
K16263  amino acid efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4141 (yjeH)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b4141 (yjeH)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 948656
NCBI-ProteinID: NP_418565
Pasteur: yjeH
RegulonDB: ECK120004329
ECOCYC: G7833
ASAP: ABE-0013559
UniProt: P39277
Position
complement(4369156..4370412)
AA seq 418 aa
MSGLKQELGLAQGIGLLSTSLLGTGVFAVPALAALVAGNNSLWAWPVLIILVFPIAIVFA
ILGRHYPSAGGVAHFVGMAFGSRLERVTGWLFLSVIPVGLPAALQIAAGFGQAMFGWHSW
QLLLAELGTLALVWYIGTRGASSSANLQTVIAGLIVALIVAIWWAGDIKPANIPFPAPGN
IELTGLFAALSVMFWCFVGLEAFAHLASEFKNPERDFPRALMIGLLLAGLVYWGCTVVVL
HFDAYGEKMAAAASLPKIVVQLFGVGALWIACVIGYLACFASLNIYIQSFARLVWSQAQH
NPDHYLARLSSRHIPNNALNAVLGCCVVSTLVIHALEINLDALIIYANGIFIMIYLLCML
AGCKLLQGRYRLLAVVGGLLCVLLLAMVGWKSLYALIMLAGLWLLLPKRKTPENGITT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagtggactcaaacaagaactggggctggcccagggcattggcctgctatcgacgtca
ttattaggcactggcgtgtttgccgttcctgcgttagctgcgctggtagcgggcaataac
agcctgtgggcgtggcccgttttgattatcttagtgttcccgattgcgattgtgtttgcg
attctgggtcgccactatcccagcgcaggcggcgtcgcgcacttcgtcggtatggcgttt
ggttcgcggcttgagcgagtcaccggctggctgtttttatcggtcattcccgtgggtttg
cctgccgcactacaaattgccgccgggttcggccaggcgatgtttggctggcatagctgg
caactgttgttggcagaactcggtacgctggcgctggtgtggtatatcggtactcgcggt
gccagttccagtgctaatctacaaaccgttattgccggacttatcgtcgcgctgattgtc
gctatctggtgggcgggcgatatcaaacctgcgaatatcccctttccggcacctggtaat
atcgaacttaccgggttatttgctgcgttatcagtgatgttctggtgttttgtcggtctg
gaggcatttgcccatctcgcctcggaatttaaaaatccagagcgtgattttcctcgtgct
ttgatgattggtctgctgctggcaggattagtctactggggctgtacggtagtcgtctta
cacttcgacgcctatggtgaaaaaatggcggcggcagcatcgcttccaaaaattgtagtg
cagttgttcggtgtaggagcgttatggattgcctgcgtgattggctatctggcctgcttt
gccagtctcaacatttatatacagagcttcgcccgcctggtctggtcgcaggcgcaacat
aatcctgaccactacctggcacgcctctcttctcgccatatcccgaataatgccctcaat
gcggtgctcggctgctgtgtggtgagcactttggtgattcatgctttagagatcaatctg
gacgctcttattatttatgccaatggcatctttattatgatttatctgttatgcatgctg
gcaggctgtaaattattgcaaggacgttatcgactactggcggtggttggcgggctgtta
tgcgttctgttactggcaatggtcggctggaaaagtctctatgcgctgatcatgctggcg
gggttatggctgttgctgccaaaacgaaaaacgccggaaaatggcataaccacataa

DBGET integrated database retrieval system