KEGG   Escherichia coli K-12 MG1655: b4148
Entry
b4148             CDS       T00007                                 
Symbol
gdx
Name
(RefSeq) guanidinium exporter
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4148 (gdx)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b4148 (gdx)
SSDB
Motif
Pfam: Multi_Drug_Res EamA DUF6541
Other DBs
NCBI-GeneID: 948671
NCBI-ProteinID: NP_418572
Pasteur: sugE
RegulonDB: ECK120001564
ECOCYC: EG11616
ASAP: ABE-0013588
UniProt: P69937
Position
4376875..4377192
AA seq 105 aa
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYA
VWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcctggattatcttagttattgctggtctgctggaagtggtatgggccgttggcctg
aaatatacccacggctttagtcgtttgacgccgagtgttattactgtgacggcgatgatt
gtcagtatggcgctacttgcctgggcgatgaaatcgttaccagtagggacggcttatgcc
gtgtggacgggtattggcgcagtcggcgcggccataaccggcattgtgctgctcggtgag
tccgctaacccgatgcgcctggcgagtctggcgttaatcgtattggggattattggtctg
aaactcagcactcactaa

DBGET integrated database retrieval system