KEGG   Escherichia coli K-12 MG1655: b4156
Entry
b4156             CDS       T00007                                 
Symbol
yjeM
Name
(RefSeq) putative transporter YjeM
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: AA_permease_2 AA_permease Tubulin
Other DBs
NCBI-GeneID: 948679
NCBI-ProteinID: NP_418580
Pasteur: yjeM
RegulonDB: ECK120002308
ECOCYC: EG12475
ASAP: ABE-0013613
UniProt: P39282
Position
4383839..4385341
AA seq 500 aa
MPHTIKKMSLIGLILMIFTSVFGFANSPSAYYLMGYSAIPFYIFSALLFFIPFALMMAEM
GAAYRKEEGGIYSWMNNSVGPRFAFIGTFMWFSSYIIWMVSTSAKVWVPFSTFLYGSDMT
QHWRIAGLEPTQVVGLLAVAWMILVTVVASKGINKIARITAVGGIAVMCLNLVLLLVSIT
ILLLNGGHFAQDINFLASPNPGYQSGLAMLSFVVFAIFAYGGIEAVGGLVDKTENPEKNF
AKGIVFAAIVISIGYSLAIFLWGVSTNWQQVLSNGSVNLGNITYVLMKSLGMTLGNALHL
SPEASLSLGVWFARITGLSMFLAYTGAFFTLCYSPLKAIIQGTPKALWPEPMTRLNAMGM
PSIAMWMQCGLVTVFILLVSFGGGTASAFFNKLTLMANVSMTLPYLFLALAFPFFKARQD
LDRPFVIFKTHLSAMIATVVVVLVVTFANVFTIIQPVVEAGDWDSTLWMIGGPVFFSLLA
MAIYQNYCSRVAKNPQWAVE
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcctcacacgataaaaaagatgagtctgataggactcatattgatgatctttacttcc
gtatttggatttgccaatagcccatcggcttattacttaatgggttatagtgcgattccc
ttttatatattttctgcattgttattctttattccattcgccttaatgatggctgaaatg
ggagctgcttatcgcaaagaagaaggcggtatctattcctggatgaataatagtgtcgga
ccacgttttgccttcattggtacgtttatgtggttttcctcttatatcatctggatggtg
agtacctccgcgaaagtttgggtaccgttctcaacattcctctatggtagcgacatgacc
cagcactggcgtattgccggactggagcctacgcaggtggttggtctgctggctgtggca
tggatgattctggtcaccgtcgttgcttctaaggggattaataaaattgcccgcattact
gcggtgggcggtattgcagtaatgtgtctgaatttagtattgctgttagtaagcattact
attttgttattaaatggtgggcatttcgcgcaggatattaatttccttgcatcaccgaac
ccgggttatcagtccggtctggcaatgctatcgtttgtggtatttgccatttttgcctat
ggcggaattgaagcggttggtggtctggtcgataaaacggaaaatccagaaaagaacttt
gccaaaggtattgtttttgccgctattgttatttcaatcggttattcgctggcaatattt
ttatggggcgtcagcacaaactggcagcaggtattaagtaatggttccgttaacctcggc
aatattacctatgtgctgatgaagagccttgggatgacgctgggtaatgcactgcatttg
tcacctgaagcgtcattgtcgctgggcgtatggtttgcgcgtattactggactttcgatg
ttcctcgcctataccggtgcgttctttacgctttgctattcaccgttgaaagccatcatc
caggggacgccgaaagcattgtggccggaaccgatgacgcgcctgaatgcgatggggatg
ccgtctatcgccatgtggatgcagtgcgggttggttactgtcttcatcctgctggtttcg
tttggtggcggtaccgcatcggcgttctttaacaagctgacgctgatggcgaacgtgtct
atgacgcttccttacctgttcctcgcgctggctttcccgttctttaaagcacgtcaggat
ctcgacagaccgtttgtgattttcaaaacgcatttgtcggcaatgattgcgacagtggtt
gtcgtactggtggtgacatttgcgaacgtcttcaccatcattcaacctgtggttgaagcc
ggagactgggacagcacattgtggatgattggcggccctgtcttcttctcgctgttagcg
atggcgatttaccagaactattgcagcagagtggcaaaaaatccgcagtgggcggtggaa
taa

DBGET integrated database retrieval system