KEGG   Escherichia coli K-12 MG1655: b4159
Entry
b4159             CDS       T00007                                 

Symbol
mscM
Name
(RefSeq) miniconductance mechanosensitive channel MscM
  KO
K22051  miniconductance mechanosensitive channel
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4159 (mscM)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b4159 (mscM)
SSDB
Motif
Pfam: MscS_TM MS_channel MscS_porin
Other DBs
NCBI-GeneID: 948676
NCBI-ProteinID: NP_418583
Pasteur: yjeP
RegulonDB: ECK120004336
ECOCYC: G7840
ASAP: ABE-0013621
UniProt: P39285
Position
complement(4386047..4389370)
AA seq 1107 aa
MRLIITFLMAWCLSWGAYAATAPDSKQITQELEQAKAAKPAQPEVVEALQSALNALEERK
GSLERIKQYQQVIDNYPKLSATLRAQLNNMRDEPRSVSPGMSTDALNQEILQVSSQLLDK
SRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLGTLTGNTPLNQAQNFALQSDS
ARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYLQALRNQLNSQRQLEAERA
LESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDLVASQQRQAASQTLQVRQAL
NTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEMAQLRVQRLRYEDLLNKQPLL
RQIHQADGQPLTAEQNRILEAQLRTQRELLNSLLQGGDTLLLELTKLKVSNGQLEDALKE
VNEATHRYLFWTSDVRPMTIAWPLEIAQDLRRLISLDTFSQLGKASVMMLTSKETILPLF
GALILVGCSIYSRRYFTRFLERSAAKVGKVTQDHFWLTLRTLFWSILVASPLPVLWMTLG
YGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFARPNGLFIAHFGWPRERVSRGMRYY
LMSIGLIVPLIMALMMFDNLDDREFSGSLGRLCFILICGALAVVTLSLKKAGIPLYLNKE
GSGDNITNHMLWNMMIGAPLVAILASAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEMLAQRARGEEEAHHHSSPEGAIEVDESEVDLDAISAQSLR
LVRSILMLIALLSVIVLWSEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILV
FIITTQLVRNLPALLELAILQHLDLTPGTGYAITTITKYLLMLIGGLVGFSMIGIEWSKL
QWLVAALGVGLGFGLQEIFANFISGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTIPAPADANSEEVTEILLTAARRCSLV
IDNPAPEVFLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQ
MRLESLNGKQTGRTLTSAGKGRQAGSL
NT seq 3324 nt   +upstreamnt  +downstreamnt
gtgcgcctgattatcacttttctgatggcctggtgcctcagttggggggcgtacgccgcg
acggcccccgatagcaaacaaatcactcaggaactggagcaggcaaaagcggcgaaaccc
gcacagccggaagtcgtagaggcgctccagtctgccttaaatgcgcttgaggaacgaaaa
ggttcccttgagcgcatcaaacaatatcagcaagttatcgataattatccgaaactctcc
gctactctgcgcgcacaattaaacaacatgcgtgacgagccgcgcagcgtgtcgccggga
atgtctaccgacgcgctgaatcaggaaattctccaggtcagcagccagttgctggataaa
agccgtcaggcccagcaagagcaggagcgcgcccgcgagattgccgattcgctgaatcaa
ctgccgcaacagcaaaccgacgcccgccgtcagttaaatgagatcgagcgccgcctggga
acgcttaccggcaatactccgctcaatcaggcacaaaatttcgcgttgcagtctgactct
gcacgtcttaaggcgctcgttgatgaactggagctggcgcagctgtctgccaataaccgc
caggaattagcgcgcttacgctcagagctggcggaaaaagagagccagcaactggatgcg
tatttgcaggccttgcgtaatcaattaaacagccaacgtcagcttgaggcggagcgggcg
ctggaaagtaccgaattgctggcagaaaacagcgccgatttgccgaaagatatcgtcgcg
caattcaaaattaaccgcgaactatcggcggctttgaatcaacaggcgcagcggatggat
ctcgttgcctcgcaacagcgtcaggctgccagccagacgttacaggtccggcaggcgttg
aatacgctgcgtgaacagtcgcaatggctgggatcgtccaatctgctcggcgaagcgctg
cgggcgcaggtggcacggctgccggaaatgccgaaaccacaacagcttgataccgaaatg
gcgcagttgcgtgtgcaacggttacgttatgaggatctgcttaataaacagccgctgcta
cggcaaattcatcaggccgacggtcagccgctgactgccgagcaaaaccgtattctggaa
gcacaactgcgcactcagcgtgagttgctgaactcattgttgcagggtggcgacacgcta
ctattggaactgaccaagctgaaagtctccaacgggcaactggaggatgcgctgaaagag
gtgaacgaagcaacgcaccgctatctgttctggacctctgacgtgcgcccgatgaccatc
gcctggccgctggaaatcgcccaggatctgcgtcgtctcatttcgctggacaccttcagt
cagttgggcaaagccagtgtgatgatgctgaccagcaaagagacaattttgccgctgttt
ggcgcgttgattctggtcggttgcagtatttactcgcgccgctatttcacccgttttctt
gaacgttcggcggcgaaagttggcaaagtgactcaggatcacttctggctgacgttgcgc
actcttttctggtcgattctcgtcgcgtcaccgttaccggtgctgtggatgacgctgggt
tacggcttgcgcgaggcgtggccttatccgctggcggtcgcgattggcgatggtgtaacg
gccaccgtgccgctgctgtgggtagtgatgatttgcgccacctttgcccgcccgaacggc
ttgtttatcgctcattttggctggccgcgcgaacgtgtttcccgtgggatgcgctactac
ctgatgagcatcgggcttattgtgccgctgattatggcgctgatgatgttcgataacctc
gacgaccgtgaattctccggttcgctgggacggctttgctttatcctcatttgcggtgcg
ctggcggtggtcaccctcagcctgaaaaaggccgggattccgctgtatctcaacaaagag
ggcagcggcgacaacattaccaaccatatgctgtggaacatgatgattggcgcgccgttg
gttgccattctggcgtcggcggtgggttatctggcaacggcacaggcgctgttagcgagg
cttgaaacctcggttgccatctggttcctgctactggtggtttatcacgttatccgccgc
tggatgctgatccagcgccgcaggctggcgtttgatcgggcgaagcatcgccgggcagag
atgttagcgcaacgtgcgcgtggcgaagaggaagcgcatcatcacagtagcccggaagga
gcaattgaagtcgatgaaagcgaagtcgatctcgatgccatcagtgcgcaatccttgcgg
ctggtgcgctcaattttgatgttgatcgccctgctttctgtcattgtgctgtggtcagaa
atccattccgctttcggcttcctcgaaaatatttcgctgtgggatgtcacctccacggta
cagggcgtagaaagtctggagccaattaccctcggtgcggtgctgattgccattctggtg
tttatcatcaccacgcagctggtgcgcaacttgcccgcgctgctggaactggcgattttg
cagcacctggatttaacgccgggtacgggttacgccatcaccaccatcaccaaatatctg
ctgatgctgattggcgggctggtcggcttctcaatgattggtattgagtggtcgaaattg
cagtggctggttgccgcgctcggtgttggtctcggttttggtttgcaggaaattttcgcc
aactttatctctggtctgattatcctgttcgaaaaaccgattcgcattggcgatacggtg
acaattcgcgatctcaccggtagcgtgacgaaaattaacacccgcgccaccaccatcagc
gactgggaccgtaaagagataatcgtgccgaacaaggcgtttattaccgagcagtttatc
aactggtcgctctctgactcggtcacgcgcgtggtgttgacgataccggcccctgccgat
gccaatagcgaagaagtgacggaaatcctgctcaccgcagcgcgtcgctgctcgctggtg
atcgacaacccggcaccggaagtcttcctggtggatctgcaacaggggattcagattttc
gagctgcgtatttacgccgctgagatgggtcaccgtatgccgctacgccatgagatccac
cagctgattctggctggcttccatgcccacggtatcgatatgccattcccgcccttccag
atgcgtctggaaagcctcaacggtaaacaaacggggagaacgctgacgtctgcgggcaaa
ggtcgtcaggcgggaagtttgtaa

DBGET integrated database retrieval system