KEGG   Escherichia coli K-12 MG1655: b4201Help
Entry
b4201             CDS       T00007                                 

Gene name
priB
Definition
(RefSeq) primosomal protein N
  KO
K02686  primosomal replication protein N
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    b4201 (priB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eco03400]
    b4201 (priB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     b4201 (priB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-GeneID: 948722
NCBI-ProteinID: NP_418622
Pasteur: priB
RegulonDB: ECK120000755
ECOCYC: EG10764
ASAP: ABE-0013742
UniProt: P07013
Structure
PDB: 

Position
4425520..4425834
Genome map
AA seq 104 aa AA seqDB search
MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ
AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtctggtgttgtccggcaccgtgtgcagggctccccttcgaaaggtcagt
ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc
ggctttcaccggcaggcgtggtgtcaaatgcccgttattgttagcggacacgaaaaccag
gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc
cacaaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata
gattctggagactag

DBGET integrated database retrieval system