KEGG   Escherichia coli K-12 MG1655: b4202Help
Entry
b4202             CDS       T00007                                 

Gene name
rpsR
Definition
(RefSeq) 30S ribosomal subunit protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    b4202 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eco03011]
    b4202 (rpsR)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b4202 (rpsR)
  Bacteria
    b4202 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 948721
NCBI-ProteinID: NP_418623
Pasteur: rpsR
RegulonDB: ECK120000908
ECOCYC: EG10917
ASAP: ABE-0013744
UniProt: P0A7T7 A0A387D6F4
Structure
PDB: 

Position
4425839..4426066
Genome map
AA seq 75 aa AA seqDB search
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLSLLPYTDRHQ
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttatttccgtcgtcgcaagttctgccgtttcaccgcggaaggcgttcaagag
atcgactataaagatatcgctacgctgaaaaactacatcaccgaaagcggtaagattgtc
ccaagccgtatcaccggtacccgtgcaaaataccagcgtcagctggctcgcgctatcaaa
cgcgctcgctacctgtccctgctgccgtacactgatcgccatcagtaa

DBGET integrated database retrieval system