KEGG   Escherichia coli K-12 MG1655: b4208Help
Entry
b4208             CDS       T00007                                 

Gene name
cycA
Definition
(RefSeq) D-alanine/D-serine/glycine transporter
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4208 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 948725
NCBI-ProteinID: NP_418629
Pasteur: cycA
RegulonDB: ECK120002311
ECOCYC: EG12504
ASAP: ABE-0013764
UniProt: P0AAE0
Position
4429864..4431276
Genome map
AA seq 470 aa AA seqDB search
MVDQVKVVADDQAPAEQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVV
AITAYAQFWFPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGL
VMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKD
PEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVIN
FVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVV
MLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCW
VCMAFFVFVVVLLTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAAELRK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcaggtaaaagtcgttgccgatgatcaggctccggctgaacagtcgctacgg
cgcaatctcacaaaccgacatattcagcttattgccattggcggtgccattggtacgggg
ttgtttatggggtctggcaaaacgattagccttgccgggccgtcgatcattttcgtttat
atgatcattggttttatgctctttttcgtgatgcgggcaatgggggaattgctgctttcg
aatctggaatacaaatcttttagtgacttcgcttccgatttactcgggccgtgggcagga
tatttcaccggctggacttactggttctgctgggttgtaaccggtatggcagacgtggtg
gcgatcacggcttatgctcagttctggttccccgatctctccgactgggtcgcctcgctg
gcggtgatagtgctgctgctgacgctcaatctcgccaccgtgaaaatgttcggtgagatg
gagttctggtttgcgatgatcaaaatcgtcgccattgtgtcgctgattgtcgtcggcctg
gtcatggtggcgatgcactttcagtcaccgactggtgtggaagcgtcattcgcgcatttg
tggaatgacggcggctggttcccgaaaggtttaagtggcttctttgccggattccagata
gcggttttcgctttcgtggggattgagctggtaggtacaacagctgcggaaaccaaagat
ccagagaaatcactgccacgcgcgattaactccattccgatccgtatcattatgttctac
gtcttcgcgctgattgtgattatgtccgtgacgccgtggagttcggtagtcccggagaaa
agcccgtttgttgaactgttcgtgttggtagggctgcctgctgccgcaagcgtgatcaac
tttgtggtgctgacctctgcggcgtcttccgctaacagcggcgtcttctctaccagccgt
atgctgtttggtctggcgcaggaaggtgtggcaccgaaagcgttcgctaaactttctaag
cgcgcagtacccgcgaaagggctgacgttctcgtgtatctgtctgctcggcggcgtggtg
atgttgtatgtgaatcctagtgtgattggcgcgttcacgatgattacaaccgtttccgcg
attctgtttatgttcgtctggacgattatcctttgctcgtaccttgtgtatcgcaaacag
cgtcctcatctacatgagaagtcgatctacaagatgccgctcggcaagctgatgtgctgg
gtatgtatggcgttctttgtgttcgtggtcgtgttgctgacactggaagatgacactcgc
caggcgctgctggttaccccgctgtggtttatcgcgctggggttgggctggctgtttatt
ggtaagaagcgggctgctgaactgcggaaataa

DBGET integrated database retrieval system