KEGG   Escherichia coli K-12 MG1655: b4220Help
Entry
b4220             CDS       T00007                                 

Gene name
tamA
Definition
(RefSeq) translocation and assembly module for autotransporter export, outer membrane subunit
  KO
K07278  translocation and assembly module TamA
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4220 (tamA)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b4220 (tamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_surface_Ag POTRA_TamA_1 POTRA
Motif
Other DBs
NCBI-GeneID: 948733
NCBI-ProteinID: NP_418641
Pasteur: ytfM
RegulonDB: ECK120004369
ECOCYC: G7874
ASAP: ABE-0013809
UniProt: P0ADE4
Structure
PDB: 

Position
4442382..4444115
Genome map
AA seq 577 aa AA seqDB search
MRYIRQLCCVSLLCLSGSAVAANVRLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRAR
VDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTD
KDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALGLHKAFWD
IDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVV
VAPQFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPRVKATWKKPWMNSYGHSLTT
STSISAPEQTLDFSYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSG
WQRAINLRWSLDHFTQGEITNTTMLFYPGVMISRTRSRGGLMPTWGDSQRYSIDYSNTAW
GSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGDFDKVPPDLRFFAGGDRSIRGYK
YKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSGEAVSDIRRSDFKTGTGV
GVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctatatccgacagttatgctgtgtaagcttactctgcttaagcggatctgccgtc
gccgcgaacgtccgtctacaggtcgaggggttatcgggacagctggaaaagaacgttcgt
gcgcagctttctacgattgaaagtgatgaagtgacgccagaccgtcgctttcgcgcacgc
gtcgatgatgccatccgcgaaggtctgaaagcgctgggttattaccagccgaccattgaa
tttgatctccgtccaccgccaaagaaagggcggcaggtattgatcgccaaagtcacgcca
ggcgtgccggtgttaattggcggcaccgatgtggtattgcgcggcggcgcgcggaccgat
aaagactatttgaaattgctcgatactcgcccggctattggcacggtactgaaccagggc
gattatgaaaatttcaaaaagtccttaaccagcattgcgttgcgtaaaggttatttcgat
agcgaatttaccaaagcgcagctgggcattgcgctcggcctgcataaagccttctgggat
attgattataacagtggcgaacgttaccgctttgggcatgtgacctttgaaggatcacaa
atccgcgatgaatacctgcaaaatctggtgccgtttaaagagggcgatgagtacgaatcg
aaagatctggcagaactgaaccgccgactttctgctaccggctggtttaactcggtggtg
gtggctccacaatttgataaagcgcgcgaaacgaaagtattaccattgacgggcgtggtt
tcgccgcgaacagaaaacaccatcgaaaccggggtcggttactctacggacgtgggaccg
cgcgtgaaagcgacgtggaaaaagccgtggatgaactcttatggtcacagtctgaccacc
agtactagtatttccgcgccggaacagaccctcgacttcagctataaaatgccgctgctg
aagaatccactggaacaatattatttggtgcagggcggttttaagcgcactgacctgaac
gataccgaatctgactccactacgctggtggcttctcgctactgggatctctccagcggc
tggcagcgtgccattaacctgcgctggagtctcgaccactttactcagggtgaaattacc
aataccacgatgctgttttatcctggggtgatgattagccgcacgcgttctcgtggtggc
ctgatgccaacctggggcgactcgcaacgctactctatcgactactccaacacggcctgg
ggttcagatgtcgatttctccgttttccaggcgcagaacgtctggatccgcacactgtac
gatcgccatcgttttgttacacgcggcacgctgggctggattgaaaccggtgatttcgac
aaagtaccgccggatctgcgtttcttcgccgggggcgaccgcagtattcgtggctacaaa
tacaaatctatcgctccgaaatacgccaacggtgacctgaaaggggcctcgaagttgata
accggatcgctggaataccagtacaacgtgaccggaaaatggtggggcgcggtgtttgtc
gatagtggcgaagcggtaagcgatattcgccgcagcgactttaaaaccggtaccggggtc
ggcgtgcgctgggaatcgccggtcgggccaatcaaactcgattttgccgtaccggtcgcg
gataaagacgaacacgggttacagttttacatcggtctggggccagaattatga

DBGET integrated database retrieval system