KEGG   Escherichia coli K-12 MG1655: b4220Help
Entry
b4220             CDS       T00007                                 

Gene name
tamA
Definition
(RefSeq) translocation and assembly module subunit TamA
  KO
K07278  translocation and assembly module TamA
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4220 (tamA)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b4220 (tamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_surface_Ag POTRA_TamA_1 POTRA
Motif
Other DBs
NCBI-GeneID: 948733
NCBI-ProteinID: NP_418641
Pasteur: ytfM
RegulonDB: ECK120004369
ECOCYC: G7874
ASAP: ABE-0013809
UniProt: P0ADE4
Structure
PDB: 

Position
4442382..4444115
Genome map
AA seq 577 aa AA seqDB search
MRYIRQLCCVSLLCLSGSAVAANVRLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRAR
VDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTD
KDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALGLHKAFWD
IDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVV
VAPQFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPRVKATWKKPWMNSYGHSLTT
STSISAPEQTLDFSYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSG
WQRAINLRWSLDHFTQGEITNTTMLFYPGVMISRTRSRGGLMPTWGDSQRYSIDYSNTAW
GSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGDFDKVPPDLRFFAGGDRSIRGYK
YKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSGEAVSDIRRSDFKTGTGV
GVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctatatccgacagttatgctgtgtaagcttactctgcttaagcggatctgccgtc
gccgcgaacgtccgtctacaggtcgaggggttatcgggacagctggaaaagaacgttcgt
gcgcagctttctacgattgaaagtgatgaagtgacgccagaccgtcgctttcgcgcacgc
gtcgatgatgccatccgcgaaggtctgaaagcgctgggttattaccagccgaccattgaa
tttgatctccgtccaccgccaaagaaagggcggcaggtattgatcgccaaagtcacgcca
ggcgtgccggtgttaattggcggcaccgatgtggtattgcgcggcggcgcgcggaccgat
aaagactatttgaaattgctcgatactcgcccggctattggcacggtactgaaccagggc
gattatgaaaatttcaaaaagtccttaaccagcattgcgttgcgtaaaggttatttcgat
agcgaatttaccaaagcgcagctgggcattgcgctcggcctgcataaagccttctgggat
attgattataacagtggcgaacgttaccgctttgggcatgtgacctttgaaggatcacaa
atccgcgatgaatacctgcaaaatctggtgccgtttaaagagggcgatgagtacgaatcg
aaagatctggcagaactgaaccgccgactttctgctaccggctggtttaactcggtggtg
gtggctccacaatttgataaagcgcgcgaaacgaaagtattaccattgacgggcgtggtt
tcgccgcgaacagaaaacaccatcgaaaccggggtcggttactctacggacgtgggaccg
cgcgtgaaagcgacgtggaaaaagccgtggatgaactcttatggtcacagtctgaccacc
agtactagtatttccgcgccggaacagaccctcgacttcagctataaaatgccgctgctg
aagaatccactggaacaatattatttggtgcagggcggttttaagcgcactgacctgaac
gataccgaatctgactccactacgctggtggcttctcgctactgggatctctccagcggc
tggcagcgtgccattaacctgcgctggagtctcgaccactttactcagggtgaaattacc
aataccacgatgctgttttatcctggggtgatgattagccgcacgcgttctcgtggtggc
ctgatgccaacctggggcgactcgcaacgctactctatcgactactccaacacggcctgg
ggttcagatgtcgatttctccgttttccaggcgcagaacgtctggatccgcacactgtac
gatcgccatcgttttgttacacgcggcacgctgggctggattgaaaccggtgatttcgac
aaagtaccgccggatctgcgtttcttcgccgggggcgaccgcagtattcgtggctacaaa
tacaaatctatcgctccgaaatacgccaacggtgacctgaaaggggcctcgaagttgata
accggatcgctggaataccagtacaacgtgaccggaaaatggtggggcgcggtgtttgtc
gatagtggcgaagcggtaagcgatattcgccgcagcgactttaaaaccggtaccggggtc
ggcgtgcgctgggaatcgccggtcgggccaatcaaactcgattttgccgtaccggtcgcg
gataaagacgaacacgggttacagttttacatcggtctggggccagaattatga

DBGET integrated database retrieval system