KEGG   Escherichia coli K-12 MG1655: b4230Help
Entry
b4230             CDS       T00007                                 

Gene name
ytfT
Definition
(RefSeq) galactofuranose ABC transporter putative membrane subunit YtfT
  KO
K23509  galactofuranose transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4230 (ytfT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4230 (ytfT)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    b4230 (ytfT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 948743
NCBI-ProteinID: NP_418651
Pasteur: ytfT
RegulonDB: ECK120002314
ECOCYC: EG12520
ASAP: ABE-0013838
UniProt: P39328
Position
4452571..4453596
Genome map
AA seq 341 aa AA seqDB search
MMPQSLPDTTTPKRRFRWPTGMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDIL
NRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGIL
AGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPT
PVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIA
GIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGIL
LSGFPPEMNQVVKAVVVLCVLIVQSQRFISLIKGVRSRDKT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcctcaatctcttccggacaccactacgccaaaaaggcgctttcgctggccgacg
gggatgccgcagctggtagcactattgctggtgctgctggtcgatagcctggtagccccg
catttctggcaggtggtgcttcaggatgggcgtttgttcggtagccccatagacattctt
aaccgtgcagctcccgttgcgttactggcgattggcatgacgctggtgatcgccaccggt
gggattgatctctccgtaggggcggtgatggctatcgccggagccacaacggctgcgatg
acggtcgcgggattcagcctgccgattgttttgttaagcgccctgggcaccggcatcctg
gcgggattgtggaacggcatactggtagcgatcctcaaaattcagccgtttgtcgccact
ctgatcctgatggtcgccgggcgcggcgtggcgcaactgatcaccgccgggcagatcgtc
acgtttaactcgccggatctctcatggttcggcagtggatcgctgttgttcctgccaacg
ccggtcattatcgcggtgctgacgcttatcctgttctggctgttgacccgcaaaacggcg
ctggggatgtttatcgaagccgttggtatcaacattcgggcggcaaaaaatgccggggta
aacacgcgaatcatcgtcatgctcacttatgtgttgagcgggctgtgtgcggcgattgcg
ggcattatcgtggcggcggatattcgcggtgccgatgccaacaacgctgggttatggctg
gagctggacgccattctcgcggtggtgattggcggcggatcgctgatgggcgggcgcttt
aacctgctactttcggtggtgggggcgctgattattcaggggatgaacaccggaattttg
ctttcgggctttccgccagagatgaaccaggtggtgaaagcggtggtggtgctttgcgtg
ctgattgttcagtcgcaacgctttatcagtctgattaaaggagtacgtagccgtgataaa
acgtaa

DBGET integrated database retrieval system