KEGG   Escherichia coli K-12 MG1655: b4238Help
Entry
b4238             CDS       T00007                                 

Gene name
nrdD
Definition
(RefSeq) anaerobic ribonucleoside-triphosphate reductase
  KO
K21636  ribonucleoside-triphosphate reductase (formate) [EC:1.1.98.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
Module
eco_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4238 (nrdD)
   00240 Pyrimidine metabolism
    b4238 (nrdD)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.98  With other, known, physiological acceptors
    1.1.98.6  ribonucleoside-triphosphate reductase (formate)
     b4238 (nrdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NRDD Gly_radical ATP-cone OrfB_Zn_ribbon NOB1_Zn_bind
Motif
Other DBs
NCBI-GeneID: 948755
NCBI-ProteinID: NP_418659
Pasteur: nrdD
RegulonDB: ECK120001382
ECOCYC: EG11417
ASAP: ABE-0013865
UniProt: P28903
Position
complement(4460522..4462660)
Genome map
AA seq 712 aa AA seqDB search
MTPHVMKRDGCKVPFKSERIKEAILRAAKAAEVDDADYCATVAAVVSEQMQGRNQVDINE
IQTAVENQLMSGPYKQLARAYIEYRHDRDIEREKRGRLNQEIRGLVEQTNASLLNENANK
DSKVIPTQRDLLAGIVAKHYARQHLLPRDVVQAHERGDIHYHDLDYSPFFPMFNCMLIDL
KGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASY
NKHRKTAEEWNIPDAEGYANSRTIKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTS
WESRLIQESILRNRIAGLGKNRKTAVFPKLVFAIRDGLNHKKGDPNYDIKQLALECASKR
MYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQIHDGRNNLGVISLNLPRIALEA
KGDEATFWKLLDERLVLARKALMTRIARLEGVKARVAPILYMEGACGVRLNADDDVSEIF
KNGRASISLGYIGIHETINALFGGEHVYDNEQLRAKGIAIVERLRQAVDQWKEETGYGFS
LYSTPSENLCDRFCRLDTAEFGVVPGVTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPL
ANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGF
TCPKCGNHDASRVSVTRRVCGYLGSPDARPFNAGKQEEVKRRVKHLGNGQIG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcatgtgatgaaacgagacggctgcaaagtgccgtttaaatcagagcgcatc
aaagaagcgattctgcgtgcagctaaagcagcggaagtcgatgatgccgattattgcgcc
actgttgccgcggttgtcagcgagcagatgcagggccgcaaccaggtggatatcaatgag
atccagaccgcagttgaaaatcagctgatgtcaggtccatacaaacaactggctcgtgct
tacatcgagtaccgtcacgatcgcgacattgaacgtgaaaaacgcggtcgcctgaaccag
gagatccgtggtctggtcgagcagaccaacgcctcgttactcaacgaaaacgccaacaaa
gacagcaaggtgattccaacccagcgcgacctgctggccgggatcgtggctaaacactat
gcacgtcagcacctgctgccgcgtgacgtggtgcaggcacatgagcgtggcgatattcac
tatcacgatctcgattactcaccgttcttcccgatgttcaactgcatgttgatcgacctg
aaaggcatgctgacccagggctttaaaatggggaacgccgagattgaaccgccgaagtcg
atctctacggcaaccgcggtaactgcgcagattattgctcaggttgccagccatatttat
ggcggcaccaccattaaccgtatcgatgaagtgctggcaccgtttgtcactgccagctac
aacaaacatcgcaagaccgcagaagagtggaacatcccggacgccgaaggctacgctaac
tctcgaaccatcaaagagtgctacgatgccttccagtcactggagtacgaagtaaacacc
ctgcacaccgccaacggtcagacgccgtttgtaacctttggttttggcctgggcaccagc
tgggaatcgcgcctgattcaggaatcgatcctgcgtaaccgtatcgcaggcctcggtaaa
aaccgtaaaactgcggtgttcccgaaactggtgtttgcgattcgcgatggcctgaaccat
aaaaaaggcgatccgaactacgacatcaaacagctggcgctggagtgcgcaagcaagcgc
atgtatccggatatcctgaactacgatcaggtagtgaaagtcaccggttcgtttaaaact
ccgatgggctgccgcagcttcctcggcgtgtgggaaaatgaaaacggcgagcagatccac
gatggtcgtaacaacctcggcgtgatcagcctgaacctgccgcgtattgctctggaagca
aaaggcgatgaagccaccttctggaagctgctggatgaacgtctggtgctggcacgtaag
gcgctgatgacccgtatcgctcgtctcgaaggcgtgaaagcgcgcgtggccccgatcctc
tatatggaaggtgcttgtggcgtgcgtctcaatgctgacgatgatgtttctgaaatcttc
aaaaacggtcgtgcgtctatttcgctgggttacatcggcatccacgaaaccattaacgcg
ctgttcggcggcgagcatgtttacgacaacgagcagcttcgcgcgaaaggtatcgccatt
gttgaacgtctgcgtcaggcagtggatcagtggaaagaagaaacgggttatggtttcagt
ctctacagcacgccgagtgaaaacctgtgcgatcgcttctgccgtctcgatactgctgag
tttggcgtggtgccgggcgtgaccgataaaggttactacaccaacagtttccacctcgat
gtggagaagaaggtgaacccgtacgacaagatcgactttgaagcgccttacccgccgctg
gcgaacggtggtttcatttgctacggcgagtatccaaacattcagcacaacctgaaggcg
ctggaagatgtctgggattacagctatcagcatgtaccgtattacggcaccaatacaccg
attgatgagtgctacgagtgtggctttaccggtgagttcgagtgcaccagcaaaggcttc
acttgcccgaaatgtggtaaccatgacgcctcccgtgtgtcggtaactcgccgcgtgtgc
ggatatttaggtagcccggatgcacgtccgtttaacgctggtaagcaggaagaagttaag
cgccgcgttaaacatttggggaatgggcagataggttaa

DBGET integrated database retrieval system