KEGG   Escherichia coli K-12 MG1655: b4242
Entry
b4242             CDS       T00007                                 

Gene name
mgtA
Definition
(RefSeq) Mg(2(+)) importing P-type ATPase
  KO
K01531  P-type Mg2+ transporter [EC:7.2.2.14]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b4242 (mgtA)
Enzymes [BR:eco01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.14  P-type Mg2+ transporter
     b4242 (mgtA)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase_N Cation_ATPase_C Cation_ATPase Hydrolase_3 HAD COX7C RskA
Other DBs
NCBI-GeneID: 948778
NCBI-ProteinID: NP_418663
Pasteur: mgtA
RegulonDB: ECK120002316
ECOCYC: EG12525
ASAP: ABE-0013883
UniProt: P0ABB8
Structure
PDB: 
3GWI

Position
4467625..4470321
AA seq 898 aa
MFKEIFTRLIRHLPSRLVHRDPLPGAQQTVNTVVPPSLSAHCLKMAVMPEEELWKTFDTH
PEGLNQAEVESAREQHGENKLPAQQPSPWWVHLWVCYRNPFNILLTILGAISYATEDLFA
AGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRVINDKGENGWLEIPIDQLV
PGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKAATTRQPEHSNPLECDTLC
FMGTTVVSGTAQAMVIATGANTWFGQLAGRVSEQESEPNAFQQGISRVSMLLIRFMLVMA
PVVLLINGYTKGDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVKHLDA
IQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERVLHSAWLNSHYQTGLKNLLDTA
VLEGTDEESARSLASRWQKIDEIPFDFERRRMSVVVAENTEHHQLVCKGALQEILNVCSQ
VRHNGEIVPLDDIMLRKIKRVTDTLNRQGLRVVAVATKYLPAREGDYQRADESDLILEGY
IAFLDPPKETTAPALKALKASGITVKILTGDSELVAAKVCHEVGLDAGEVVIGSDIETLS
DDELANLAQRTTLFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVDG
AVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFL
PFLPMLPLHLLIQNLLYDVSQVAIPFDNVDDEQIQKPQRWNPADLGRFMIFFGPISSIFD
ILTFCLMWWVFHANTPETQTLFQSGWFVVGLLSQTLIVHMIRTRRVPFIQSCASWPLMIM
TVIVMIVGIALPFSPLASYLQLQALPLSYFPWLVAILAGYMTLTQLVKGFYSRRYGWQ
NT seq 2697 nt   +upstreamnt  +downstreamnt
atgtttaaagaaatttttacccggctcattcgccatttaccttcccgtctggttcatcgt
gatccattgcctggcgcgcagcagacagtgaatacggtggtcccgccgtccttaagtgcg
cattgcctgaaaatggcggtgatgcccgaagaagaattgtggaaaacgttcgacacccat
ccggaagggttaaatcaggcggaagtggaatctgcccgcgaacaacatggtgaaaataaa
ttacccgcacaacaaccgtcgccgtggtgggtacatttatgggtctgctatcgcaacccc
tttaatattttactcaccattctcggcgctatttcttacgccacggaagatttatttgct
gcgggcgttatcgcgctaatggtcgctatttctacgttgctgaactttattcaggaagca
cgttccactaaagcggcagatgccctgaaagcgatggtcagcaatactgcgacggtgctg
cgcgtaattaacgacaaaggcgaaaatggctggctggagatcccgatcgaccagctggtg
cccggcgatattataaaactggcggcgggagatatgatcccggcagatttacgtatcttg
caggcgcgggatctgttcgtcgctcaggcgtcgttaaccggtgagtctctgcccgtagaa
aaagccgctaccactcgccagccggagcacagcaatccgctggagtgcgacacgctgtgt
tttatgggcaccaccgtggtgagcggcacggcacaagcaatggtgattgctacaggtgcc
aatacctggtttggtcaactggcggggcgtgttagtgagcaggaaagcgagccgaatgcc
tttcagcaagggatcagccgcgtcagtatgctgctgattcgctttatgctggtgatggca
ccggtggtgctgttaatcaatggttacaccaaaggcgactggtgggaagcggcgctgttt
gcgctttcggtcgcggtaggcctaacgccggaaatgttgccgatgattgttacctcgacg
ctggcgcgcggcgcagtaaagctgtcgaaacagaaagtgatcgtcaaacatctggatgct
attcagaactttggcgcaatggatattctgtgcactgataaaaccggcaccctgacgcag
gataaaattgtgctggagaatcataccgatatctccggtaaaaccagcgaacgcgtgctg
catagcgcgtggttgaacagtcattatcagaccggacttaaaaacctgctcgatacagcg
gtgctcgaaggtacggatgaagagtcagcgcgctcgctggccagtcgttggcaaaaaatt
gatgagattccgtttgatttcgagcgtcgccggatgtcggtggtagtggcagaaaatacc
gagcaccatcagctggtttgcaaaggtgcattgcaggaaatcctcaatgtgtgttcgcag
gtgcgtcacaatggcgagattgtgccgctcgatgacatcatgctgcgtaagattaagcgg
gttactgatacgctgaatcgtcaggggctgcgcgtggttgcggtggcgacgaaatacctg
ccagcgcgtgaaggagattaccagcgggcggatgaatccgacctgatcctcgaaggatat
attgcttttcttgatccgccaaaagagacaaccgctccggcactgaaggcattaaaagcg
agtggaattaccgtaaaaatccttactggcgacagtgagttagttgcagcgaaagtgtgc
catgaagtggggctggacgcgggagaggtggtcattggtagtgatattgaaacgctatct
gacgacgaactggcaaatcttgcacagcgtaccacgctgtttgcccgcctgacgccgatg
cataaagaacgcattgtgaccttactgaagcgcgaagggcatgtggttggctttatgggc
gatggtattaatgatgcgcccgccttacgcgctgcggatatcggcatttctgtggacggc
gcggtagatattgcccgtgaagcggctgatatcatcctgctggaaaaaagcctgatggtg
ctggaagagggggttattgagggacgtcgcactttcgccaacatgctgaaatacatcaaa
atgacggcgagctctaacttcggtaatgtgttcagcgtgctggtagcgagtgctttcttg
cccttcctgccgatgttgccgttacacttgcttattcagaacctgctgtacgatgtgtca
caggtggcgatcccgtttgataacgtcgacgacgagcaaattcaaaagccgcagcgttgg
aatccggcggatctggggcgctttatgatcttcttcggaccgatcagctcgatcttcgat
attttgacgttttgcctgatgtggtgggtattccatgccaacacgccggaaacgcaaacg
ctgttccagtcgggatggtttgtggtgggcttactgtcgcaaacgctgattgtgcatatg
atccgcacccgccgtgtgccgtttattcagagctgtgcatcgtggccgttaatgatcatg
accgtgatcgtgatgattgtcgggatcgcattgccgttttcaccgctggccagttatctg
caattacaggcgctgccgttaagctatttcccgtggctggttgcgattctggcagggtat
atgacattaacccagttggtgaaagggttctatagccgtcgttacggctggcaataa

DBGET integrated database retrieval system